Compare commits
164 Commits
377e501d34
...
dev/2024/1
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
24580fdfd8 | ||
|
|
7c0a124a5d | ||
|
|
11e32ddfda | ||
|
|
4dcdab9931 | ||
|
|
f965eea33a | ||
|
|
c3c73ee517 | ||
|
|
8308940674 | ||
|
|
bc06f86fdc | ||
|
|
2c25b33bcc | ||
|
|
8651884ca6 | ||
|
|
7447c7b536 | ||
|
|
3e8d796b2e | ||
|
|
fcd4b47951 | ||
|
|
b15131bf1e | ||
|
|
2c5c51e05f | ||
|
|
51275dd539 | ||
|
|
f1ae1c598f | ||
|
|
91ba8ec86f | ||
|
|
323f810fcd | ||
|
|
8969ea895f | ||
|
|
67f7eef636 | ||
|
|
4f8b50577a | ||
|
|
67e41503c9 | ||
|
|
30e0bb3665 | ||
|
|
291c627c79 | ||
|
|
89306f4a04 | ||
|
|
721d69e766 | ||
|
|
356fd35b08 | ||
|
|
92bd85e1dd | ||
|
|
22129048e7 | ||
|
|
781e4cd6e1 | ||
|
|
46558672e8 | ||
|
|
3c544c559b | ||
|
|
4367a5183a | ||
|
|
03e4e75978 | ||
|
|
98eb515c19 | ||
|
|
dd3f332870 | ||
|
|
9d7ef94fa6 | ||
| ce315b8778 | |||
|
|
ab4e3e199c | ||
|
|
2c1a0b919b | ||
|
|
cd6f97cd7e | ||
|
|
5312755f32 | ||
|
|
55cb5ed745 | ||
|
|
f0d8e156a9 | ||
|
|
c19279fad3 | ||
| 0d50b44c37 | |||
|
|
b32d46b641 | ||
|
|
5c43eb2c73 | ||
|
|
540fe37b9d | ||
|
|
2a4f923552 | ||
|
|
4821db89cc | ||
|
|
d1733a5888 | ||
|
|
dd8458fa96 | ||
|
|
850c66cd8d | ||
|
|
2597235d0c | ||
|
|
db9a3b3ed3 | ||
|
|
31b0e9f195 | ||
|
|
5b07e73382 | ||
|
|
c1732baa0d | ||
|
|
de96ab0e25 | ||
|
|
cd58b7861b | ||
|
|
8d2f61fa65 | ||
|
|
3d7dd37c11 | ||
|
|
f373528b06 | ||
|
|
3fe9555cb1 | ||
|
|
f94e2bd831 | ||
|
|
685f1e56d7 | ||
|
|
ea0c9e7812 | ||
|
|
52cb793d06 | ||
|
|
4a2a63b0b0 | ||
|
|
9f96abbd43 | ||
|
|
57bf025622 | ||
|
|
bcadb68189 | ||
|
|
d7d7837c1f | ||
|
|
82fab771ab | ||
|
|
85fff24cc1 | ||
|
|
9326d6c76c | ||
|
|
eefb3ceb44 | ||
|
|
2959387bcd | ||
|
|
41b07cfe83 | ||
|
|
981e745eb0 | ||
|
|
8760e47283 | ||
|
|
1db3ab9090 | ||
|
|
9a1769e200 | ||
|
|
8c150c0bb1 | ||
|
|
69929b28dd | ||
| f41b50c9e0 | |||
|
|
d6b99454d2 | ||
|
|
1fc3c1632d | ||
|
|
9141029557 | ||
|
|
9d5b57fd56 | ||
|
|
0756cf74c4 | ||
|
|
bd5727c758 | ||
|
|
0ebd823656 | ||
|
|
7c6c9e5995 | ||
|
|
f4cd8318b0 | ||
|
|
e06f3da2bd | ||
|
|
fb8a911d4d | ||
|
|
4e1c71b221 | ||
|
|
0f8a272b71 | ||
|
|
508c8cdc42 | ||
|
|
ee55c807ef | ||
|
|
10a5b92740 | ||
|
|
d3eacd48aa | ||
|
|
53f05058f3 | ||
|
|
c0ea724d4c | ||
|
|
57c15270dc | ||
|
|
7533dd0b11 | ||
|
|
dd80b30e26 | ||
|
|
0508d95e33 | ||
|
|
f2cc3e4d16 | ||
|
|
9526c383f3 | ||
|
|
dd88a1838d | ||
|
|
72ffd399b3 | ||
|
|
020ad7c6d1 | ||
|
|
1fc4d6531d | ||
|
|
d8bb659e78 | ||
|
|
6ade69ac35 | ||
|
|
ed7149e5f4 | ||
|
|
e2df3c4825 | ||
|
|
266703cdc0 | ||
|
|
f635ea3c97 | ||
|
|
304aeb16bd | ||
|
|
ed00c72e59 | ||
|
|
835458e0f3 | ||
|
|
3b9e9a2c8f | ||
|
|
fadb2a71c2 | ||
|
|
91434051c6 | ||
|
|
c1161f6c1f | ||
|
|
3b4efce02f | ||
|
|
2aaf55b72f | ||
|
|
d493856d20 | ||
|
|
67647c7923 | ||
|
|
3c61e5cb7f | ||
|
|
37e0e1ef06 | ||
|
|
725e18d480 | ||
|
|
3d383527e4 | ||
|
|
48e8dff52b | ||
|
|
0b53406b52 | ||
|
|
232d019b40 | ||
|
|
35190adcdf | ||
|
|
d4199b2810 | ||
|
|
971c1b0dda | ||
|
|
4fe1f521b7 | ||
|
|
38b1d86514 | ||
|
|
4899583b15 | ||
|
|
792951afa8 | ||
|
|
5004aa3376 | ||
|
|
9ba338a4f1 | ||
|
|
8795d7a276 | ||
|
|
89adfb151a | ||
|
|
9fd8a5866a | ||
|
|
7564fac345 | ||
|
|
6bd27e4bca | ||
|
|
26cfe60f16 | ||
|
|
32a1220072 | ||
|
|
9852aea94b | ||
|
|
f76767ca6d | ||
|
|
1b60725e9c | ||
|
|
b8cb2cb0b9 | ||
|
|
228f7501bb | ||
|
|
f4ef0a2666 | ||
|
|
60e68ed31c |
504
poetry.lock
generated
504
poetry.lock
generated
@@ -1,4 +1,15 @@
|
|||||||
# This file is automatically @generated by Poetry 1.8.4 and should not be changed by hand.
|
# This file is automatically @generated by Poetry 1.7.1 and should not be changed by hand.
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "absl-py"
|
||||||
|
version = "2.1.0"
|
||||||
|
description = "Abseil Python Common Libraries, see https://github.com/abseil/abseil-py."
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.7"
|
||||||
|
files = [
|
||||||
|
{file = "absl-py-2.1.0.tar.gz", hash = "sha256:7820790efbb316739cde8b4e19357243fc3608a152024288513dd968d7d959ff"},
|
||||||
|
{file = "absl_py-2.1.0-py3-none-any.whl", hash = "sha256:526a04eadab8b4ee719ce68f204172ead1027549089702d99b9059f129ff1308"},
|
||||||
|
]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "appnope"
|
name = "appnope"
|
||||||
@@ -133,6 +144,30 @@ traitlets = ">=4"
|
|||||||
[package.extras]
|
[package.extras]
|
||||||
test = ["pytest"]
|
test = ["pytest"]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "cplex"
|
||||||
|
version = "22.1.1.2"
|
||||||
|
description = "A Python interface to the CPLEX Callable Library, Community Edition."
|
||||||
|
optional = false
|
||||||
|
python-versions = "*"
|
||||||
|
files = [
|
||||||
|
{file = "cplex-22.1.1.2-cp310-cp310-macosx_10_6_x86_64.whl", hash = "sha256:d74a91f6e9c6f4ad4c7c69f7ab937ea9e91178a556f6f105c87eef9e434ea42e"},
|
||||||
|
{file = "cplex-22.1.1.2-cp310-cp310-macosx_11_0_arm64.whl", hash = "sha256:b066b5aa01fcf7cb471ad41920b3fecdd87dc95686e9a7031ff470873f0db10f"},
|
||||||
|
{file = "cplex-22.1.1.2-cp310-cp310-manylinux1_x86_64.whl", hash = "sha256:a7230032928b1a657c384d3f49c04d8b80d0ab8134a2f4c0b26ff50e71ec767a"},
|
||||||
|
{file = "cplex-22.1.1.2-cp310-cp310-manylinux2014_ppc64le.whl", hash = "sha256:dd81e8ee7a7f1fb5769bcbb1349b084b37c495cbd0db1a095d774f97d790ee3c"},
|
||||||
|
{file = "cplex-22.1.1.2-cp310-cp310-win_amd64.whl", hash = "sha256:68b33bb9ff84be3442a6f71000e7214781c6aa8674143a9aa79cb9a84e697dfd"},
|
||||||
|
{file = "cplex-22.1.1.2-cp311-cp311-macosx_10_6_x86_64.whl", hash = "sha256:cda2f59af50d6c3d6476b2e38aba1e947f9bd72591d71961a9d53b5582062ba9"},
|
||||||
|
{file = "cplex-22.1.1.2-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:0f69a539ed50994e26e32c3d2b203eb5f112d1ba64400241614e1a91c0933974"},
|
||||||
|
{file = "cplex-22.1.1.2-cp311-cp311-manylinux1_x86_64.whl", hash = "sha256:2a0f6984980779e6878a6cded52ee08806bae49af6bd209c7740549417e69e96"},
|
||||||
|
{file = "cplex-22.1.1.2-cp311-cp311-manylinux2014_ppc64le.whl", hash = "sha256:0ac0005414a09facbeaa976a89b3153d4ed15f23a89bf5d283f65d4e951f63be"},
|
||||||
|
{file = "cplex-22.1.1.2-cp311-cp311-win_amd64.whl", hash = "sha256:46550cac476d74cc95dc3abf6f9bfe08c9fd61d889e20f2028f754b9fe503b88"},
|
||||||
|
{file = "cplex-22.1.1.2-cp39-cp39-macosx_10_6_x86_64.whl", hash = "sha256:21f6fd1ad4876a7775e64fe8a1fb43f6bb7a010c5e099abdb8c01887a8cc1d84"},
|
||||||
|
{file = "cplex-22.1.1.2-cp39-cp39-macosx_11_0_arm64.whl", hash = "sha256:d6acbf74c3fe32f2138a98730d1ebe3fa275c8c3fdcd8b1f68d312bfe9ef6899"},
|
||||||
|
{file = "cplex-22.1.1.2-cp39-cp39-manylinux1_x86_64.whl", hash = "sha256:3211f9c84f44c6317ea1e83a6c2ff1cfdc08532f421987b7faa8c07a018dfae5"},
|
||||||
|
{file = "cplex-22.1.1.2-cp39-cp39-manylinux2014_ppc64le.whl", hash = "sha256:648ad8c1c83ea30b0802c571a0dbf7fac23dcb9dc121ea0768c1794313aec2a7"},
|
||||||
|
{file = "cplex-22.1.1.2-cp39-cp39-win_amd64.whl", hash = "sha256:285b26008a77942c6c9c29bff91e1658c1beed2aa520e1a8b26137d81abf81dc"},
|
||||||
|
]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "debugpy"
|
name = "debugpy"
|
||||||
version = "1.8.9"
|
version = "1.8.9"
|
||||||
@@ -179,6 +214,19 @@ files = [
|
|||||||
{file = "decorator-5.1.1.tar.gz", hash = "sha256:637996211036b6385ef91435e4fae22989472f9d571faba8927ba8253acbc330"},
|
{file = "decorator-5.1.1.tar.gz", hash = "sha256:637996211036b6385ef91435e4fae22989472f9d571faba8927ba8253acbc330"},
|
||||||
]
|
]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "docplex"
|
||||||
|
version = "2.28.240"
|
||||||
|
description = "The IBM Decision Optimization CPLEX Modeling for Python"
|
||||||
|
optional = false
|
||||||
|
python-versions = "*"
|
||||||
|
files = [
|
||||||
|
{file = "docplex-2.28.240.tar.gz", hash = "sha256:c0de407e33f8709bb4cd91b6efeb96fd88bfecbdce2caec51afb79253bde6ff5"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.dependencies]
|
||||||
|
six = "*"
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "exceptiongroup"
|
name = "exceptiongroup"
|
||||||
version = "1.2.2"
|
version = "1.2.2"
|
||||||
@@ -207,6 +255,50 @@ files = [
|
|||||||
[package.extras]
|
[package.extras]
|
||||||
tests = ["asttokens (>=2.1.0)", "coverage", "coverage-enable-subprocess", "ipython", "littleutils", "pytest", "rich"]
|
tests = ["asttokens (>=2.1.0)", "coverage", "coverage-enable-subprocess", "ipython", "littleutils", "pytest", "rich"]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "imageio"
|
||||||
|
version = "2.36.1"
|
||||||
|
description = "Library for reading and writing a wide range of image, video, scientific, and volumetric data formats."
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.9"
|
||||||
|
files = [
|
||||||
|
{file = "imageio-2.36.1-py3-none-any.whl", hash = "sha256:20abd2cae58e55ca1af8a8dcf43293336a59adf0391f1917bf8518633cfc2cdf"},
|
||||||
|
{file = "imageio-2.36.1.tar.gz", hash = "sha256:e4e1d231f47f9a9e16100b0f7ce1a86e8856fb4d1c0fa2c4365a316f1746be62"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.dependencies]
|
||||||
|
numpy = "*"
|
||||||
|
pillow = ">=8.3.2"
|
||||||
|
|
||||||
|
[package.extras]
|
||||||
|
all-plugins = ["astropy", "av", "imageio-ffmpeg", "numpy (>2)", "pillow-heif", "psutil", "rawpy", "tifffile"]
|
||||||
|
all-plugins-pypy = ["av", "imageio-ffmpeg", "pillow-heif", "psutil", "tifffile"]
|
||||||
|
build = ["wheel"]
|
||||||
|
dev = ["black", "flake8", "fsspec[github]", "pytest", "pytest-cov"]
|
||||||
|
docs = ["numpydoc", "pydata-sphinx-theme", "sphinx (<6)"]
|
||||||
|
ffmpeg = ["imageio-ffmpeg", "psutil"]
|
||||||
|
fits = ["astropy"]
|
||||||
|
full = ["astropy", "av", "black", "flake8", "fsspec[github]", "gdal", "imageio-ffmpeg", "itk", "numpy (>2)", "numpydoc", "pillow-heif", "psutil", "pydata-sphinx-theme", "pytest", "pytest-cov", "rawpy", "sphinx (<6)", "tifffile", "wheel"]
|
||||||
|
gdal = ["gdal"]
|
||||||
|
itk = ["itk"]
|
||||||
|
linting = ["black", "flake8"]
|
||||||
|
pillow-heif = ["pillow-heif"]
|
||||||
|
pyav = ["av"]
|
||||||
|
rawpy = ["numpy (>2)", "rawpy"]
|
||||||
|
test = ["fsspec[github]", "pytest", "pytest-cov"]
|
||||||
|
tifffile = ["tifffile"]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "immutabledict"
|
||||||
|
version = "4.2.1"
|
||||||
|
description = "Immutable wrapper around dictionaries (a fork of frozendict)"
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.8"
|
||||||
|
files = [
|
||||||
|
{file = "immutabledict-4.2.1-py3-none-any.whl", hash = "sha256:c56a26ced38c236f79e74af3ccce53772827cef5c3bce7cab33ff2060f756373"},
|
||||||
|
{file = "immutabledict-4.2.1.tar.gz", hash = "sha256:d91017248981c72eb66c8ff9834e99c2f53562346f23e7f51e7a5ebcf66a3bcc"},
|
||||||
|
]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "ipykernel"
|
name = "ipykernel"
|
||||||
version = "6.29.5"
|
version = "6.29.5"
|
||||||
@@ -430,68 +522,133 @@ files = [
|
|||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "numpy"
|
name = "numpy"
|
||||||
version = "2.1.3"
|
version = "2.2.0"
|
||||||
description = "Fundamental package for array computing in Python"
|
description = "Fundamental package for array computing in Python"
|
||||||
optional = false
|
optional = false
|
||||||
python-versions = ">=3.10"
|
python-versions = ">=3.10"
|
||||||
files = [
|
files = [
|
||||||
{file = "numpy-2.1.3-cp310-cp310-macosx_10_9_x86_64.whl", hash = "sha256:c894b4305373b9c5576d7a12b473702afdf48ce5369c074ba304cc5ad8730dff"},
|
{file = "numpy-2.2.0-cp310-cp310-macosx_10_9_x86_64.whl", hash = "sha256:1e25507d85da11ff5066269d0bd25d06e0a0f2e908415534f3e603d2a78e4ffa"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-macosx_11_0_arm64.whl", hash = "sha256:b47fbb433d3260adcd51eb54f92a2ffbc90a4595f8970ee00e064c644ac788f5"},
|
{file = "numpy-2.2.0-cp310-cp310-macosx_11_0_arm64.whl", hash = "sha256:a62eb442011776e4036af5c8b1a00b706c5bc02dc15eb5344b0c750428c94219"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-macosx_14_0_arm64.whl", hash = "sha256:825656d0743699c529c5943554d223c021ff0494ff1442152ce887ef4f7561a1"},
|
{file = "numpy-2.2.0-cp310-cp310-macosx_14_0_arm64.whl", hash = "sha256:b606b1aaf802e6468c2608c65ff7ece53eae1a6874b3765f69b8ceb20c5fa78e"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-macosx_14_0_x86_64.whl", hash = "sha256:6a4825252fcc430a182ac4dee5a505053d262c807f8a924603d411f6718b88fd"},
|
{file = "numpy-2.2.0-cp310-cp310-macosx_14_0_x86_64.whl", hash = "sha256:36b2b43146f646642b425dd2027730f99bac962618ec2052932157e213a040e9"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:e711e02f49e176a01d0349d82cb5f05ba4db7d5e7e0defd026328e5cfb3226d3"},
|
{file = "numpy-2.2.0-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:7fe8f3583e0607ad4e43a954e35c1748b553bfe9fdac8635c02058023277d1b3"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:78574ac2d1a4a02421f25da9559850d59457bac82f2b8d7a44fe83a64f770098"},
|
{file = "numpy-2.2.0-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:122fd2fcfafdefc889c64ad99c228d5a1f9692c3a83f56c292618a59aa60ae83"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-musllinux_1_1_x86_64.whl", hash = "sha256:c7662f0e3673fe4e832fe07b65c50342ea27d989f92c80355658c7f888fcc83c"},
|
{file = "numpy-2.2.0-cp310-cp310-musllinux_1_2_aarch64.whl", hash = "sha256:3f2f5cddeaa4424a0a118924b988746db6ffa8565e5829b1841a8a3bd73eb59a"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-musllinux_1_2_aarch64.whl", hash = "sha256:fa2d1337dc61c8dc417fbccf20f6d1e139896a30721b7f1e832b2bb6ef4eb6c4"},
|
{file = "numpy-2.2.0-cp310-cp310-musllinux_1_2_x86_64.whl", hash = "sha256:7fe4bb0695fe986a9e4deec3b6857003b4cfe5c5e4aac0b95f6a658c14635e31"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-win32.whl", hash = "sha256:72dcc4a35a8515d83e76b58fdf8113a5c969ccd505c8a946759b24e3182d1f23"},
|
{file = "numpy-2.2.0-cp310-cp310-win32.whl", hash = "sha256:b30042fe92dbd79f1ba7f6898fada10bdaad1847c44f2dff9a16147e00a93661"},
|
||||||
{file = "numpy-2.1.3-cp310-cp310-win_amd64.whl", hash = "sha256:ecc76a9ba2911d8d37ac01de72834d8849e55473457558e12995f4cd53e778e0"},
|
{file = "numpy-2.2.0-cp310-cp310-win_amd64.whl", hash = "sha256:54dc1d6d66f8d37843ed281773c7174f03bf7ad826523f73435deb88ba60d2d4"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:4d1167c53b93f1f5d8a139a742b3c6f4d429b54e74e6b57d0eff40045187b15d"},
|
{file = "numpy-2.2.0-cp311-cp311-macosx_10_9_x86_64.whl", hash = "sha256:9874bc2ff574c40ab7a5cbb7464bf9b045d617e36754a7bc93f933d52bd9ffc6"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:c80e4a09b3d95b4e1cac08643f1152fa71a0a821a2d4277334c88d54b2219a41"},
|
{file = "numpy-2.2.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:0da8495970f6b101ddd0c38ace92edea30e7e12b9a926b57f5fabb1ecc25bb90"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-macosx_14_0_arm64.whl", hash = "sha256:576a1c1d25e9e02ed7fa5477f30a127fe56debd53b8d2c89d5578f9857d03ca9"},
|
{file = "numpy-2.2.0-cp311-cp311-macosx_14_0_arm64.whl", hash = "sha256:0557eebc699c1c34cccdd8c3778c9294e8196df27d713706895edc6f57d29608"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-macosx_14_0_x86_64.whl", hash = "sha256:973faafebaae4c0aaa1a1ca1ce02434554d67e628b8d805e61f874b84e136b09"},
|
{file = "numpy-2.2.0-cp311-cp311-macosx_14_0_x86_64.whl", hash = "sha256:3579eaeb5e07f3ded59298ce22b65f877a86ba8e9fe701f5576c99bb17c283da"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:762479be47a4863e261a840e8e01608d124ee1361e48b96916f38b119cfda04a"},
|
{file = "numpy-2.2.0-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:40deb10198bbaa531509aad0cd2f9fadb26c8b94070831e2208e7df543562b74"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:bc6f24b3d1ecc1eebfbf5d6051faa49af40b03be1aaa781ebdadcbc090b4539b"},
|
{file = "numpy-2.2.0-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:c2aed8fcf8abc3020d6a9ccb31dbc9e7d7819c56a348cc88fd44be269b37427e"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-musllinux_1_1_x86_64.whl", hash = "sha256:17ee83a1f4fef3c94d16dc1802b998668b5419362c8a4f4e8a491de1b41cc3ee"},
|
{file = "numpy-2.2.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:a222d764352c773aa5ebde02dd84dba3279c81c6db2e482d62a3fa54e5ece69b"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:15cb89f39fa6d0bdfb600ea24b250e5f1a3df23f901f51c8debaa6a5d122b2f0"},
|
{file = "numpy-2.2.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:4e58666988605e251d42c2818c7d3d8991555381be26399303053b58a5bbf30d"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-win32.whl", hash = "sha256:d9beb777a78c331580705326d2367488d5bc473b49a9bc3036c154832520aca9"},
|
{file = "numpy-2.2.0-cp311-cp311-win32.whl", hash = "sha256:4723a50e1523e1de4fccd1b9a6dcea750c2102461e9a02b2ac55ffeae09a4410"},
|
||||||
{file = "numpy-2.1.3-cp311-cp311-win_amd64.whl", hash = "sha256:d89dd2b6da69c4fff5e39c28a382199ddedc3a5be5390115608345dec660b9e2"},
|
{file = "numpy-2.2.0-cp311-cp311-win_amd64.whl", hash = "sha256:16757cf28621e43e252c560d25b15f18a2f11da94fea344bf26c599b9cf54b73"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:f55ba01150f52b1027829b50d70ef1dafd9821ea82905b63936668403c3b471e"},
|
{file = "numpy-2.2.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:cff210198bb4cae3f3c100444c5eaa573a823f05c253e7188e1362a5555235b3"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:13138eadd4f4da03074851a698ffa7e405f41a0845a6b1ad135b81596e4e9958"},
|
{file = "numpy-2.2.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:58b92a5828bd4d9aa0952492b7de803135038de47343b2aa3cc23f3b71a3dc4e"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-macosx_14_0_arm64.whl", hash = "sha256:a6b46587b14b888e95e4a24d7b13ae91fa22386c199ee7b418f449032b2fa3b8"},
|
{file = "numpy-2.2.0-cp312-cp312-macosx_14_0_arm64.whl", hash = "sha256:ebe5e59545401fbb1b24da76f006ab19734ae71e703cdb4a8b347e84a0cece67"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-macosx_14_0_x86_64.whl", hash = "sha256:0fa14563cc46422e99daef53d725d0c326e99e468a9320a240affffe87852564"},
|
{file = "numpy-2.2.0-cp312-cp312-macosx_14_0_x86_64.whl", hash = "sha256:e2b8cd48a9942ed3f85b95ca4105c45758438c7ed28fff1e4ce3e57c3b589d8e"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:8637dcd2caa676e475503d1f8fdb327bc495554e10838019651b76d17b98e512"},
|
{file = "numpy-2.2.0-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:57fcc997ffc0bef234b8875a54d4058afa92b0b0c4223fc1f62f24b3b5e86038"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:2312b2aa89e1f43ecea6da6ea9a810d06aae08321609d8dc0d0eda6d946a541b"},
|
{file = "numpy-2.2.0-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:85ad7d11b309bd132d74397fcf2920933c9d1dc865487128f5c03d580f2c3d03"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-musllinux_1_1_x86_64.whl", hash = "sha256:a38c19106902bb19351b83802531fea19dee18e5b37b36454f27f11ff956f7fc"},
|
{file = "numpy-2.2.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:cb24cca1968b21355cc6f3da1a20cd1cebd8a023e3c5b09b432444617949085a"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:02135ade8b8a84011cbb67dc44e07c58f28575cf9ecf8ab304e51c05528c19f0"},
|
{file = "numpy-2.2.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:0798b138c291d792f8ea40fe3768610f3c7dd2574389e37c3f26573757c8f7ef"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-win32.whl", hash = "sha256:e6988e90fcf617da2b5c78902fe8e668361b43b4fe26dbf2d7b0f8034d4cafb9"},
|
{file = "numpy-2.2.0-cp312-cp312-win32.whl", hash = "sha256:afe8fb968743d40435c3827632fd36c5fbde633b0423da7692e426529b1759b1"},
|
||||||
{file = "numpy-2.1.3-cp312-cp312-win_amd64.whl", hash = "sha256:0d30c543f02e84e92c4b1f415b7c6b5326cbe45ee7882b6b77db7195fb971e3a"},
|
{file = "numpy-2.2.0-cp312-cp312-win_amd64.whl", hash = "sha256:3a4199f519e57d517ebd48cb76b36c82da0360781c6a0353e64c0cac30ecaad3"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:96fe52fcdb9345b7cd82ecd34547fca4321f7656d500eca497eb7ea5a926692f"},
|
{file = "numpy-2.2.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:f8c8b141ef9699ae777c6278b52c706b653bf15d135d302754f6b2e90eb30367"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:f653490b33e9c3a4c1c01d41bc2aef08f9475af51146e4a7710c450cf9761598"},
|
{file = "numpy-2.2.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:0f0986e917aca18f7a567b812ef7ca9391288e2acb7a4308aa9d265bd724bdae"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-macosx_14_0_arm64.whl", hash = "sha256:dc258a761a16daa791081d026f0ed4399b582712e6fc887a95af09df10c5ca57"},
|
{file = "numpy-2.2.0-cp313-cp313-macosx_14_0_arm64.whl", hash = "sha256:1c92113619f7b272838b8d6702a7f8ebe5edea0df48166c47929611d0b4dea69"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-macosx_14_0_x86_64.whl", hash = "sha256:016d0f6f5e77b0f0d45d77387ffa4bb89816b57c835580c3ce8e099ef830befe"},
|
{file = "numpy-2.2.0-cp313-cp313-macosx_14_0_x86_64.whl", hash = "sha256:5a145e956b374e72ad1dff82779177d4a3c62bc8248f41b80cb5122e68f22d13"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:c181ba05ce8299c7aa3125c27b9c2167bca4a4445b7ce73d5febc411ca692e43"},
|
{file = "numpy-2.2.0-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:18142b497d70a34b01642b9feabb70156311b326fdddd875a9981f34a369b671"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:5641516794ca9e5f8a4d17bb45446998c6554704d888f86df9b200e66bdcce56"},
|
{file = "numpy-2.2.0-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:a7d41d1612c1a82b64697e894b75db6758d4f21c3ec069d841e60ebe54b5b571"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-musllinux_1_1_x86_64.whl", hash = "sha256:ea4dedd6e394a9c180b33c2c872b92f7ce0f8e7ad93e9585312b0c5a04777a4a"},
|
{file = "numpy-2.2.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:a98f6f20465e7618c83252c02041517bd2f7ea29be5378f09667a8f654a5918d"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:b0df3635b9c8ef48bd3be5f862cf71b0a4716fa0e702155c45067c6b711ddcef"},
|
{file = "numpy-2.2.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:e09d40edfdb4e260cb1567d8ae770ccf3b8b7e9f0d9b5c2a9992696b30ce2742"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-win32.whl", hash = "sha256:50ca6aba6e163363f132b5c101ba078b8cbd3fa92c7865fd7d4d62d9779ac29f"},
|
{file = "numpy-2.2.0-cp313-cp313-win32.whl", hash = "sha256:3905a5fffcc23e597ee4d9fb3fcd209bd658c352657548db7316e810ca80458e"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313-win_amd64.whl", hash = "sha256:747641635d3d44bcb380d950679462fae44f54b131be347d5ec2bce47d3df9ed"},
|
{file = "numpy-2.2.0-cp313-cp313-win_amd64.whl", hash = "sha256:a184288538e6ad699cbe6b24859206e38ce5fba28f3bcfa51c90d0502c1582b2"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:996bb9399059c5b82f76b53ff8bb686069c05acc94656bb259b1d63d04a9506f"},
|
{file = "numpy-2.2.0-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:7832f9e8eb00be32f15fdfb9a981d6955ea9adc8574c521d48710171b6c55e95"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:45966d859916ad02b779706bb43b954281db43e185015df6eb3323120188f9e4"},
|
{file = "numpy-2.2.0-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:f0dd071b95bbca244f4cb7f70b77d2ff3aaaba7fa16dc41f58d14854a6204e6c"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-macosx_14_0_arm64.whl", hash = "sha256:baed7e8d7481bfe0874b566850cb0b85243e982388b7b23348c6db2ee2b2ae8e"},
|
{file = "numpy-2.2.0-cp313-cp313t-macosx_14_0_arm64.whl", hash = "sha256:b0b227dcff8cdc3efbce66d4e50891f04d0a387cce282fe1e66199146a6a8fca"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-macosx_14_0_x86_64.whl", hash = "sha256:a9f7f672a3388133335589cfca93ed468509cb7b93ba3105fce780d04a6576a0"},
|
{file = "numpy-2.2.0-cp313-cp313t-macosx_14_0_x86_64.whl", hash = "sha256:6ab153263a7c5ccaf6dfe7e53447b74f77789f28ecb278c3b5d49db7ece10d6d"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:d7aac50327da5d208db2eec22eb11e491e3fe13d22653dce51b0f4109101b408"},
|
{file = "numpy-2.2.0-cp313-cp313t-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:e500aba968a48e9019e42c0c199b7ec0696a97fa69037bea163b55398e390529"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:4394bc0dbd074b7f9b52024832d16e019decebf86caf909d94f6b3f77a8ee3b6"},
|
{file = "numpy-2.2.0-cp313-cp313t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:440cfb3db4c5029775803794f8638fbdbf71ec702caf32735f53b008e1eaece3"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-musllinux_1_1_x86_64.whl", hash = "sha256:50d18c4358a0a8a53f12a8ba9d772ab2d460321e6a93d6064fc22443d189853f"},
|
{file = "numpy-2.2.0-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:a55dc7a7f0b6198b07ec0cd445fbb98b05234e8b00c5ac4874a63372ba98d4ab"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-musllinux_1_2_aarch64.whl", hash = "sha256:14e253bd43fc6b37af4921b10f6add6925878a42a0c5fe83daee390bca80bc17"},
|
{file = "numpy-2.2.0-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:4bddbaa30d78c86329b26bd6aaaea06b1e47444da99eddac7bf1e2fab717bd72"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-win32.whl", hash = "sha256:08788d27a5fd867a663f6fc753fd7c3ad7e92747efc73c53bca2f19f8bc06f48"},
|
{file = "numpy-2.2.0-cp313-cp313t-win32.whl", hash = "sha256:30bf971c12e4365153afb31fc73f441d4da157153f3400b82db32d04de1e4066"},
|
||||||
{file = "numpy-2.1.3-cp313-cp313t-win_amd64.whl", hash = "sha256:2564fbdf2b99b3f815f2107c1bbc93e2de8ee655a69c261363a1172a79a257d4"},
|
{file = "numpy-2.2.0-cp313-cp313t-win_amd64.whl", hash = "sha256:d35717333b39d1b6bb8433fa758a55f1081543de527171543a2b710551d40881"},
|
||||||
{file = "numpy-2.1.3-pp310-pypy310_pp73-macosx_10_15_x86_64.whl", hash = "sha256:4f2015dfe437dfebbfce7c85c7b53d81ba49e71ba7eadbf1df40c915af75979f"},
|
{file = "numpy-2.2.0-pp310-pypy310_pp73-macosx_10_15_x86_64.whl", hash = "sha256:e12c6c1ce84628c52d6367863773f7c8c8241be554e8b79686e91a43f1733773"},
|
||||||
{file = "numpy-2.1.3-pp310-pypy310_pp73-macosx_14_0_x86_64.whl", hash = "sha256:3522b0dfe983a575e6a9ab3a4a4dfe156c3e428468ff08ce582b9bb6bd1d71d4"},
|
{file = "numpy-2.2.0-pp310-pypy310_pp73-macosx_14_0_x86_64.whl", hash = "sha256:b6207dc8fb3c8cb5668e885cef9ec7f70189bec4e276f0ff70d5aa078d32c88e"},
|
||||||
{file = "numpy-2.1.3-pp310-pypy310_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:c006b607a865b07cd981ccb218a04fc86b600411d83d6fc261357f1c0966755d"},
|
{file = "numpy-2.2.0-pp310-pypy310_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:a50aeff71d0f97b6450d33940c7181b08be1441c6c193e678211bff11aa725e7"},
|
||||||
{file = "numpy-2.1.3-pp310-pypy310_pp73-win_amd64.whl", hash = "sha256:e14e26956e6f1696070788252dcdff11b4aca4c3e8bd166e0df1bb8f315a67cb"},
|
{file = "numpy-2.2.0-pp310-pypy310_pp73-win_amd64.whl", hash = "sha256:df12a1f99b99f569a7c2ae59aa2d31724e8d835fc7f33e14f4792e3071d11221"},
|
||||||
{file = "numpy-2.1.3.tar.gz", hash = "sha256:aa08e04e08aaf974d4458def539dece0d28146d866a39da5639596f4921fd761"},
|
{file = "numpy-2.2.0.tar.gz", hash = "sha256:140dd80ff8981a583a60980be1a655068f8adebf7a45a06a6858c873fcdcd4a0"},
|
||||||
]
|
]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "opencv-python"
|
||||||
|
version = "4.10.0.84"
|
||||||
|
description = "Wrapper package for OpenCV python bindings."
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.6"
|
||||||
|
files = [
|
||||||
|
{file = "opencv-python-4.10.0.84.tar.gz", hash = "sha256:72d234e4582e9658ffea8e9cae5b63d488ad06994ef12d81dc303b17472f3526"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-macosx_11_0_arm64.whl", hash = "sha256:fc182f8f4cda51b45f01c64e4cbedfc2f00aff799debebc305d8d0210c43f251"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-macosx_12_0_x86_64.whl", hash = "sha256:71e575744f1d23f79741450254660442785f45a0797212852ee5199ef12eed98"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:09a332b50488e2dda866a6c5573ee192fe3583239fb26ff2f7f9ceb0bc119ea6"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:9ace140fc6d647fbe1c692bcb2abce768973491222c067c131d80957c595b71f"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-win32.whl", hash = "sha256:2db02bb7e50b703f0a2d50c50ced72e95c574e1e5a0bb35a8a86d0b35c98c236"},
|
||||||
|
{file = "opencv_python-4.10.0.84-cp37-abi3-win_amd64.whl", hash = "sha256:32dbbd94c26f611dc5cc6979e6b7aa1f55a64d6b463cc1dcd3c95505a63e48fe"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.dependencies]
|
||||||
|
numpy = [
|
||||||
|
{version = ">=1.26.0", markers = "python_version >= \"3.12\""},
|
||||||
|
{version = ">=1.23.5", markers = "python_version >= \"3.11\" and python_version < \"3.12\""},
|
||||||
|
{version = ">=1.21.4", markers = "python_version >= \"3.10\" and platform_system == \"Darwin\" and python_version < \"3.11\""},
|
||||||
|
{version = ">=1.21.2", markers = "platform_system != \"Darwin\" and python_version >= \"3.10\" and python_version < \"3.11\""},
|
||||||
|
]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "ortools"
|
||||||
|
version = "9.11.4210"
|
||||||
|
description = "Google OR-Tools python libraries and modules"
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.8"
|
||||||
|
files = [
|
||||||
|
{file = "ortools-9.11.4210-cp310-cp310-macosx_10_15_x86_64.whl", hash = "sha256:127f20f03ce04c28f979eac635d1cacdc01597c9e035a1981070506294d7db9c"},
|
||||||
|
{file = "ortools-9.11.4210-cp310-cp310-macosx_11_0_arm64.whl", hash = "sha256:250c62ba9e5fcaf18ada449bc0128c71bb0dbea83ddec5559cc506cff920235c"},
|
||||||
|
{file = "ortools-9.11.4210-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:c7c15cefc7bc71aa2f70bee157aaa7e51ed8cb74c3edd499d15b6f5cd79cdf5b"},
|
||||||
|
{file = "ortools-9.11.4210-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:9c3693f0cb07ee0b5d36c4817bcfe05a745e3a613798a2ed62eb998d7fff979c"},
|
||||||
|
{file = "ortools-9.11.4210-cp310-cp310-win_amd64.whl", hash = "sha256:6b9d4ae6c7e9efac7cbef8a6289e97e238c2f0a8ef587b3e56b71af14c2f04e6"},
|
||||||
|
{file = "ortools-9.11.4210-cp311-cp311-macosx_10_15_x86_64.whl", hash = "sha256:0f902caa1576d737714f6a4fa165db62469bce82115e250409607197b3b6b434"},
|
||||||
|
{file = "ortools-9.11.4210-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:c6f3e2869396dc6d8ee2d11b65d6f88f6386bb3ad64212c0ad7a6d32ddcb48ca"},
|
||||||
|
{file = "ortools-9.11.4210-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:a56c5844ff927ce3c5428159cdd01b7fdbe243e8062bf1dfdb2e0eb305a55a30"},
|
||||||
|
{file = "ortools-9.11.4210-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:d5a17a37aeaa7d149e2fe8c8dfd5f09630ae28ad734a109ad55536605f8059df"},
|
||||||
|
{file = "ortools-9.11.4210-cp311-cp311-win_amd64.whl", hash = "sha256:d9b858f0273e19f81555428d54d407428d0a70a8cb5df2c320935bb735f2c6bb"},
|
||||||
|
{file = "ortools-9.11.4210-cp312-cp312-macosx_10_15_x86_64.whl", hash = "sha256:079bea08c6341dcfe3fb9586eb6edec6ae80f4ed16ed366fd7a46ef4b5709009"},
|
||||||
|
{file = "ortools-9.11.4210-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:7f55124f9d1afa6434d0d6de07c6a4eb836f29b00b3413d27138634d5d79b606"},
|
||||||
|
{file = "ortools-9.11.4210-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:1f48e3d4053a169440608d881c1abd2a706db885d9b0af85bf45b444a1fec244"},
|
||||||
|
{file = "ortools-9.11.4210-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:03ecd32e5d760d48e59832ef6bf724f8cac95e4e40db72a7fb912abf7adcf931"},
|
||||||
|
{file = "ortools-9.11.4210-cp312-cp312-win_amd64.whl", hash = "sha256:bc1b6e4cc0a121ef888481a99194765e6df72d4d3da81f928543171a2bac8cbb"},
|
||||||
|
{file = "ortools-9.11.4210-cp38-cp38-macosx_10_15_x86_64.whl", hash = "sha256:a503291dc12dc44da48567c5e1f79c77cd054fb86176f2c99d2860bc5a57e03d"},
|
||||||
|
{file = "ortools-9.11.4210-cp38-cp38-macosx_11_0_arm64.whl", hash = "sha256:2fd0aa0b4edfb3088f086bc05d42a381cc3d03da4b8ad18ce18ba213ab2c719f"},
|
||||||
|
{file = "ortools-9.11.4210-cp38-cp38-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:2c242738a49279c3a58b4611a64dd24634f1638f4dbb435163e3f9308e7c84c9"},
|
||||||
|
{file = "ortools-9.11.4210-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:db9186bbc7a30538f277e704e9e77ff52bc75aa2c17095a125b2dc212a75cf8e"},
|
||||||
|
{file = "ortools-9.11.4210-cp38-cp38-win_amd64.whl", hash = "sha256:afcca4919e1095a79af0375276c5377a2d75794ebd592c4cc841d9979e0526e7"},
|
||||||
|
{file = "ortools-9.11.4210-cp39-cp39-macosx_10_15_x86_64.whl", hash = "sha256:a2828e91960c4e4fcf27bc6e200e2cd61ce1c42d4a3b95481a842a58c8315345"},
|
||||||
|
{file = "ortools-9.11.4210-cp39-cp39-macosx_11_0_arm64.whl", hash = "sha256:8d7d1a105f105502cf2f785816b09b796e5845fd47efac0dc0e3c0476b4c961a"},
|
||||||
|
{file = "ortools-9.11.4210-cp39-cp39-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:9f250641d7b822be25237fb78aed0878b07e8afdefddb700bafcc52f32ad520a"},
|
||||||
|
{file = "ortools-9.11.4210-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:bd2c0b319f4c0999360ab45a85d5764838c9dd0fd33437d12e32b2c07cbe04e4"},
|
||||||
|
{file = "ortools-9.11.4210-cp39-cp39-win_amd64.whl", hash = "sha256:219ffa56e8e4f52561586cea3dd55eb0f5d174a84c83a819d71debad766338e3"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.dependencies]
|
||||||
|
absl-py = ">=2.0.0"
|
||||||
|
immutabledict = ">=3.0.0"
|
||||||
|
numpy = ">=1.13.3"
|
||||||
|
pandas = ">=2.0.0"
|
||||||
|
protobuf = ">=5.26.1,<5.27"
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "packaging"
|
name = "packaging"
|
||||||
version = "24.2"
|
version = "24.2"
|
||||||
@@ -556,9 +713,9 @@ files = [
|
|||||||
|
|
||||||
[package.dependencies]
|
[package.dependencies]
|
||||||
numpy = [
|
numpy = [
|
||||||
{version = ">=1.22.4", markers = "python_version < \"3.11\""},
|
|
||||||
{version = ">=1.23.2", markers = "python_version == \"3.11\""},
|
|
||||||
{version = ">=1.26.0", markers = "python_version >= \"3.12\""},
|
{version = ">=1.26.0", markers = "python_version >= \"3.12\""},
|
||||||
|
{version = ">=1.23.2", markers = "python_version == \"3.11\""},
|
||||||
|
{version = ">=1.22.4", markers = "python_version < \"3.11\""},
|
||||||
]
|
]
|
||||||
python-dateutil = ">=2.8.2"
|
python-dateutil = ">=2.8.2"
|
||||||
pytz = ">=2020.1"
|
pytz = ">=2020.1"
|
||||||
@@ -640,6 +797,98 @@ files = [
|
|||||||
[package.dependencies]
|
[package.dependencies]
|
||||||
ptyprocess = ">=0.5"
|
ptyprocess = ">=0.5"
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "pillow"
|
||||||
|
version = "11.0.0"
|
||||||
|
description = "Python Imaging Library (Fork)"
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.9"
|
||||||
|
files = [
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-macosx_10_10_x86_64.whl", hash = "sha256:6619654954dc4936fcff82db8eb6401d3159ec6be81e33c6000dfd76ae189947"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-macosx_11_0_arm64.whl", hash = "sha256:b3c5ac4bed7519088103d9450a1107f76308ecf91d6dabc8a33a2fcfb18d0fba"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:a65149d8ada1055029fcb665452b2814fe7d7082fcb0c5bed6db851cb69b2086"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:88a58d8ac0cc0e7f3a014509f0455248a76629ca9b604eca7dc5927cc593c5e9"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-manylinux_2_28_aarch64.whl", hash = "sha256:c26845094b1af3c91852745ae78e3ea47abf3dbcd1cf962f16b9a5fbe3ee8488"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-manylinux_2_28_x86_64.whl", hash = "sha256:1a61b54f87ab5786b8479f81c4b11f4d61702830354520837f8cc791ebba0f5f"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-musllinux_1_2_aarch64.whl", hash = "sha256:674629ff60030d144b7bca2b8330225a9b11c482ed408813924619c6f302fdbb"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-musllinux_1_2_x86_64.whl", hash = "sha256:598b4e238f13276e0008299bd2482003f48158e2b11826862b1eb2ad7c768b97"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-win32.whl", hash = "sha256:9a0f748eaa434a41fccf8e1ee7a3eed68af1b690e75328fd7a60af123c193b50"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-win_amd64.whl", hash = "sha256:a5629742881bcbc1f42e840af185fd4d83a5edeb96475a575f4da50d6ede337c"},
|
||||||
|
{file = "pillow-11.0.0-cp310-cp310-win_arm64.whl", hash = "sha256:ee217c198f2e41f184f3869f3e485557296d505b5195c513b2bfe0062dc537f1"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-macosx_10_10_x86_64.whl", hash = "sha256:1c1d72714f429a521d8d2d018badc42414c3077eb187a59579f28e4270b4b0fc"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-macosx_11_0_arm64.whl", hash = "sha256:499c3a1b0d6fc8213519e193796eb1a86a1be4b1877d678b30f83fd979811d1a"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:c8b2351c85d855293a299038e1f89db92a2f35e8d2f783489c6f0b2b5f3fe8a3"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:6f4dba50cfa56f910241eb7f883c20f1e7b1d8f7d91c750cd0b318bad443f4d5"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-manylinux_2_28_aarch64.whl", hash = "sha256:5ddbfd761ee00c12ee1be86c9c0683ecf5bb14c9772ddbd782085779a63dd55b"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-manylinux_2_28_x86_64.whl", hash = "sha256:45c566eb10b8967d71bf1ab8e4a525e5a93519e29ea071459ce517f6b903d7fa"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-musllinux_1_2_aarch64.whl", hash = "sha256:b4fd7bd29610a83a8c9b564d457cf5bd92b4e11e79a4ee4716a63c959699b306"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:cb929ca942d0ec4fac404cbf520ee6cac37bf35be479b970c4ffadf2b6a1cad9"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-win32.whl", hash = "sha256:006bcdd307cc47ba43e924099a038cbf9591062e6c50e570819743f5607404f5"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-win_amd64.whl", hash = "sha256:52a2d8323a465f84faaba5236567d212c3668f2ab53e1c74c15583cf507a0291"},
|
||||||
|
{file = "pillow-11.0.0-cp311-cp311-win_arm64.whl", hash = "sha256:16095692a253047fe3ec028e951fa4221a1f3ed3d80c397e83541a3037ff67c9"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:d2c0a187a92a1cb5ef2c8ed5412dd8d4334272617f532d4ad4de31e0495bd923"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-macosx_11_0_arm64.whl", hash = "sha256:084a07ef0821cfe4858fe86652fffac8e187b6ae677e9906e192aafcc1b69903"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:8069c5179902dcdce0be9bfc8235347fdbac249d23bd90514b7a47a72d9fecf4"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:f02541ef64077f22bf4924f225c0fd1248c168f86e4b7abdedd87d6ebaceab0f"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-manylinux_2_28_aarch64.whl", hash = "sha256:fcb4621042ac4b7865c179bb972ed0da0218a076dc1820ffc48b1d74c1e37fe9"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-manylinux_2_28_x86_64.whl", hash = "sha256:00177a63030d612148e659b55ba99527803288cea7c75fb05766ab7981a8c1b7"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-musllinux_1_2_aarch64.whl", hash = "sha256:8853a3bf12afddfdf15f57c4b02d7ded92c7a75a5d7331d19f4f9572a89c17e6"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:3107c66e43bda25359d5ef446f59c497de2b5ed4c7fdba0894f8d6cf3822dafc"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-win32.whl", hash = "sha256:86510e3f5eca0ab87429dd77fafc04693195eec7fd6a137c389c3eeb4cfb77c6"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-win_amd64.whl", hash = "sha256:8ec4a89295cd6cd4d1058a5e6aec6bf51e0eaaf9714774e1bfac7cfc9051db47"},
|
||||||
|
{file = "pillow-11.0.0-cp312-cp312-win_arm64.whl", hash = "sha256:27a7860107500d813fcd203b4ea19b04babe79448268403172782754870dac25"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:bcd1fb5bb7b07f64c15618c89efcc2cfa3e95f0e3bcdbaf4642509de1942a699"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-macosx_11_0_arm64.whl", hash = "sha256:0e038b0745997c7dcaae350d35859c9715c71e92ffb7e0f4a8e8a16732150f38"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:0ae08bd8ffc41aebf578c2af2f9d8749d91f448b3bfd41d7d9ff573d74f2a6b2"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:d69bfd8ec3219ae71bcde1f942b728903cad25fafe3100ba2258b973bd2bc1b2"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-manylinux_2_28_aarch64.whl", hash = "sha256:61b887f9ddba63ddf62fd02a3ba7add935d053b6dd7d58998c630e6dbade8527"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-manylinux_2_28_x86_64.whl", hash = "sha256:c6a660307ca9d4867caa8d9ca2c2658ab685de83792d1876274991adec7b93fa"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-musllinux_1_2_aarch64.whl", hash = "sha256:73e3a0200cdda995c7e43dd47436c1548f87a30bb27fb871f352a22ab8dcf45f"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:fba162b8872d30fea8c52b258a542c5dfd7b235fb5cb352240c8d63b414013eb"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-win32.whl", hash = "sha256:f1b82c27e89fffc6da125d5eb0ca6e68017faf5efc078128cfaa42cf5cb38798"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-win_amd64.whl", hash = "sha256:8ba470552b48e5835f1d23ecb936bb7f71d206f9dfeee64245f30c3270b994de"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313-win_arm64.whl", hash = "sha256:846e193e103b41e984ac921b335df59195356ce3f71dcfd155aa79c603873b84"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-macosx_10_13_x86_64.whl", hash = "sha256:4ad70c4214f67d7466bea6a08061eba35c01b1b89eaa098040a35272a8efb22b"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-macosx_11_0_arm64.whl", hash = "sha256:6ec0d5af64f2e3d64a165f490d96368bb5dea8b8f9ad04487f9ab60dc4bb6003"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:c809a70e43c7977c4a42aefd62f0131823ebf7dd73556fa5d5950f5b354087e2"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-manylinux_2_28_x86_64.whl", hash = "sha256:4b60c9520f7207aaf2e1d94de026682fc227806c6e1f55bba7606d1c94dd623a"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-musllinux_1_2_x86_64.whl", hash = "sha256:1e2688958a840c822279fda0086fec1fdab2f95bf2b717b66871c4ad9859d7e8"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-win32.whl", hash = "sha256:607bbe123c74e272e381a8d1957083a9463401f7bd01287f50521ecb05a313f8"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-win_amd64.whl", hash = "sha256:5c39ed17edea3bc69c743a8dd3e9853b7509625c2462532e62baa0732163a904"},
|
||||||
|
{file = "pillow-11.0.0-cp313-cp313t-win_arm64.whl", hash = "sha256:75acbbeb05b86bc53cbe7b7e6fe00fbcf82ad7c684b3ad82e3d711da9ba287d3"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-macosx_10_10_x86_64.whl", hash = "sha256:2e46773dc9f35a1dd28bd6981332fd7f27bec001a918a72a79b4133cf5291dba"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-macosx_11_0_arm64.whl", hash = "sha256:2679d2258b7f1192b378e2893a8a0a0ca472234d4c2c0e6bdd3380e8dfa21b6a"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:eda2616eb2313cbb3eebbe51f19362eb434b18e3bb599466a1ffa76a033fb916"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:20ec184af98a121fb2da42642dea8a29ec80fc3efbaefb86d8fdd2606619045d"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-manylinux_2_28_aarch64.whl", hash = "sha256:8594f42df584e5b4bb9281799698403f7af489fba84c34d53d1c4bfb71b7c4e7"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-manylinux_2_28_x86_64.whl", hash = "sha256:c12b5ae868897c7338519c03049a806af85b9b8c237b7d675b8c5e089e4a618e"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-musllinux_1_2_aarch64.whl", hash = "sha256:70fbbdacd1d271b77b7721fe3cdd2d537bbbd75d29e6300c672ec6bb38d9672f"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-musllinux_1_2_x86_64.whl", hash = "sha256:5178952973e588b3f1360868847334e9e3bf49d19e169bbbdfaf8398002419ae"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-win32.whl", hash = "sha256:8c676b587da5673d3c75bd67dd2a8cdfeb282ca38a30f37950511766b26858c4"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-win_amd64.whl", hash = "sha256:94f3e1780abb45062287b4614a5bc0874519c86a777d4a7ad34978e86428b8dd"},
|
||||||
|
{file = "pillow-11.0.0-cp39-cp39-win_arm64.whl", hash = "sha256:290f2cc809f9da7d6d622550bbf4c1e57518212da51b6a30fe8e0a270a5b78bd"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-macosx_10_15_x86_64.whl", hash = "sha256:1187739620f2b365de756ce086fdb3604573337cc28a0d3ac4a01ab6b2d2a6d2"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-macosx_11_0_arm64.whl", hash = "sha256:fbbcb7b57dc9c794843e3d1258c0fbf0f48656d46ffe9e09b63bbd6e8cd5d0a2"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:5d203af30149ae339ad1b4f710d9844ed8796e97fda23ffbc4cc472968a47d0b"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:21a0d3b115009ebb8ac3d2ebec5c2982cc693da935f4ab7bb5c8ebe2f47d36f2"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-manylinux_2_28_aarch64.whl", hash = "sha256:73853108f56df97baf2bb8b522f3578221e56f646ba345a372c78326710d3830"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-manylinux_2_28_x86_64.whl", hash = "sha256:e58876c91f97b0952eb766123bfef372792ab3f4e3e1f1a2267834c2ab131734"},
|
||||||
|
{file = "pillow-11.0.0-pp310-pypy310_pp73-win_amd64.whl", hash = "sha256:224aaa38177597bb179f3ec87eeefcce8e4f85e608025e9cfac60de237ba6316"},
|
||||||
|
{file = "pillow-11.0.0-pp39-pypy39_pp73-macosx_11_0_arm64.whl", hash = "sha256:5bd2d3bdb846d757055910f0a59792d33b555800813c3b39ada1829c372ccb06"},
|
||||||
|
{file = "pillow-11.0.0-pp39-pypy39_pp73-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:375b8dd15a1f5d2feafff536d47e22f69625c1aa92f12b339ec0b2ca40263273"},
|
||||||
|
{file = "pillow-11.0.0-pp39-pypy39_pp73-manylinux_2_28_x86_64.whl", hash = "sha256:daffdf51ee5db69a82dd127eabecce20729e21f7a3680cf7cbb23f0829189790"},
|
||||||
|
{file = "pillow-11.0.0-pp39-pypy39_pp73-win_amd64.whl", hash = "sha256:7326a1787e3c7b0429659e0a944725e1b03eeaa10edd945a86dead1913383944"},
|
||||||
|
{file = "pillow-11.0.0.tar.gz", hash = "sha256:72bacbaf24ac003fea9bff9837d1eedb6088758d41e100c1552930151f677739"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.extras]
|
||||||
|
docs = ["furo", "olefile", "sphinx (>=8.1)", "sphinx-copybutton", "sphinx-inline-tabs", "sphinxext-opengraph"]
|
||||||
|
fpx = ["olefile"]
|
||||||
|
mic = ["olefile"]
|
||||||
|
tests = ["check-manifest", "coverage", "defusedxml", "markdown2", "olefile", "packaging", "pyroma", "pytest", "pytest-cov", "pytest-timeout"]
|
||||||
|
typing = ["typing-extensions"]
|
||||||
|
xmp = ["defusedxml"]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "platformdirs"
|
name = "platformdirs"
|
||||||
version = "4.3.6"
|
version = "4.3.6"
|
||||||
@@ -689,6 +938,26 @@ files = [
|
|||||||
[package.dependencies]
|
[package.dependencies]
|
||||||
wcwidth = "*"
|
wcwidth = "*"
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "protobuf"
|
||||||
|
version = "5.26.1"
|
||||||
|
description = ""
|
||||||
|
optional = false
|
||||||
|
python-versions = ">=3.8"
|
||||||
|
files = [
|
||||||
|
{file = "protobuf-5.26.1-cp310-abi3-win32.whl", hash = "sha256:3c388ea6ddfe735f8cf69e3f7dc7611e73107b60bdfcf5d0f024c3ccd3794e23"},
|
||||||
|
{file = "protobuf-5.26.1-cp310-abi3-win_amd64.whl", hash = "sha256:e6039957449cb918f331d32ffafa8eb9255769c96aa0560d9a5bf0b4e00a2a33"},
|
||||||
|
{file = "protobuf-5.26.1-cp37-abi3-macosx_10_9_universal2.whl", hash = "sha256:38aa5f535721d5bb99861166c445c4105c4e285c765fbb2ac10f116e32dcd46d"},
|
||||||
|
{file = "protobuf-5.26.1-cp37-abi3-manylinux2014_aarch64.whl", hash = "sha256:fbfe61e7ee8c1860855696e3ac6cfd1b01af5498facc6834fcc345c9684fb2ca"},
|
||||||
|
{file = "protobuf-5.26.1-cp37-abi3-manylinux2014_x86_64.whl", hash = "sha256:f7417703f841167e5a27d48be13389d52ad705ec09eade63dfc3180a959215d7"},
|
||||||
|
{file = "protobuf-5.26.1-cp38-cp38-win32.whl", hash = "sha256:d693d2504ca96750d92d9de8a103102dd648fda04540495535f0fec7577ed8fc"},
|
||||||
|
{file = "protobuf-5.26.1-cp38-cp38-win_amd64.whl", hash = "sha256:9b557c317ebe6836835ec4ef74ec3e994ad0894ea424314ad3552bc6e8835b4e"},
|
||||||
|
{file = "protobuf-5.26.1-cp39-cp39-win32.whl", hash = "sha256:b9ba3ca83c2e31219ffbeb9d76b63aad35a3eb1544170c55336993d7a18ae72c"},
|
||||||
|
{file = "protobuf-5.26.1-cp39-cp39-win_amd64.whl", hash = "sha256:7ee014c2c87582e101d6b54260af03b6596728505c79f17c8586e7523aaa8f8c"},
|
||||||
|
{file = "protobuf-5.26.1-py3-none-any.whl", hash = "sha256:da612f2720c0183417194eeaa2523215c4fcc1a1949772dc65f05047e08d5932"},
|
||||||
|
{file = "protobuf-5.26.1.tar.gz", hash = "sha256:8ca2a1d97c290ec7b16e4e5dff2e5ae150cc1582f55b5ab300d45cb0dfa90e51"},
|
||||||
|
]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "psutil"
|
name = "psutil"
|
||||||
version = "6.1.0"
|
version = "6.1.0"
|
||||||
@@ -755,6 +1024,19 @@ files = [
|
|||||||
{file = "pycparser-2.22.tar.gz", hash = "sha256:491c8be9c040f5390f5bf44a5b07752bd07f56edf992381b05c701439eec10f6"},
|
{file = "pycparser-2.22.tar.gz", hash = "sha256:491c8be9c040f5390f5bf44a5b07752bd07f56edf992381b05c701439eec10f6"},
|
||||||
]
|
]
|
||||||
|
|
||||||
|
[[package]]
|
||||||
|
name = "pygifsicle"
|
||||||
|
version = "1.1.0"
|
||||||
|
description = "Python package wrapping the gifsicle library for editing and optimizing gifs."
|
||||||
|
optional = false
|
||||||
|
python-versions = "*"
|
||||||
|
files = [
|
||||||
|
{file = "pygifsicle-1.1.0.tar.gz", hash = "sha256:dcef433520ace4c1136dfc7060e77042142a3dbd6bdb6a19bd9149ef5cbe7441"},
|
||||||
|
]
|
||||||
|
|
||||||
|
[package.extras]
|
||||||
|
test = ["pytest", "pytest-cov", "touch", "validate_version_code"]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "pygments"
|
name = "pygments"
|
||||||
version = "2.18.0"
|
version = "2.18.0"
|
||||||
@@ -771,13 +1053,13 @@ windows-terminal = ["colorama (>=0.4.6)"]
|
|||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "pyright"
|
name = "pyright"
|
||||||
version = "1.1.389"
|
version = "1.1.390"
|
||||||
description = "Command line wrapper for pyright"
|
description = "Command line wrapper for pyright"
|
||||||
optional = false
|
optional = false
|
||||||
python-versions = ">=3.7"
|
python-versions = ">=3.7"
|
||||||
files = [
|
files = [
|
||||||
{file = "pyright-1.1.389-py3-none-any.whl", hash = "sha256:41e9620bba9254406dc1f621a88ceab5a88af4c826feb4f614d95691ed243a60"},
|
{file = "pyright-1.1.390-py3-none-any.whl", hash = "sha256:ecebfba5b6b50af7c1a44c2ba144ba2ab542c227eb49bc1f16984ff714e0e110"},
|
||||||
{file = "pyright-1.1.389.tar.gz", hash = "sha256:716bf8cc174ab8b4dcf6828c3298cac05c5ed775dda9910106a5dcfe4c7fe220"},
|
{file = "pyright-1.1.390.tar.gz", hash = "sha256:aad7f160c49e0fbf8209507a15e17b781f63a86a1facb69ca877c71ef2e9538d"},
|
||||||
]
|
]
|
||||||
|
|
||||||
[package.dependencies]
|
[package.dependencies]
|
||||||
@@ -1026,90 +1308,40 @@ cffi = {version = "*", markers = "implementation_name == \"pypy\""}
|
|||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "ruff"
|
name = "ruff"
|
||||||
version = "0.8.1"
|
version = "0.8.3"
|
||||||
description = "An extremely fast Python linter and code formatter, written in Rust."
|
description = "An extremely fast Python linter and code formatter, written in Rust."
|
||||||
optional = false
|
optional = false
|
||||||
python-versions = ">=3.7"
|
python-versions = ">=3.7"
|
||||||
files = [
|
files = [
|
||||||
{file = "ruff-0.8.1-py3-none-linux_armv6l.whl", hash = "sha256:fae0805bd514066f20309f6742f6ee7904a773eb9e6c17c45d6b1600ca65c9b5"},
|
{file = "ruff-0.8.3-py3-none-linux_armv6l.whl", hash = "sha256:8d5d273ffffff0acd3db5bf626d4b131aa5a5ada1276126231c4174543ce20d6"},
|
||||||
{file = "ruff-0.8.1-py3-none-macosx_10_12_x86_64.whl", hash = "sha256:b8a4f7385c2285c30f34b200ca5511fcc865f17578383db154e098150ce0a087"},
|
{file = "ruff-0.8.3-py3-none-macosx_10_12_x86_64.whl", hash = "sha256:e4d66a21de39f15c9757d00c50c8cdd20ac84f55684ca56def7891a025d7e939"},
|
||||||
{file = "ruff-0.8.1-py3-none-macosx_11_0_arm64.whl", hash = "sha256:cd054486da0c53e41e0086e1730eb77d1f698154f910e0cd9e0d64274979a209"},
|
{file = "ruff-0.8.3-py3-none-macosx_11_0_arm64.whl", hash = "sha256:c356e770811858bd20832af696ff6c7e884701115094f427b64b25093d6d932d"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:2029b8c22da147c50ae577e621a5bfbc5d1fed75d86af53643d7a7aee1d23871"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:9c0a60a825e3e177116c84009d5ebaa90cf40dfab56e1358d1df4e29a9a14b13"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:2666520828dee7dfc7e47ee4ea0d928f40de72056d929a7c5292d95071d881d1"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_armv7l.manylinux2014_armv7l.whl", hash = "sha256:75fb782f4db39501210ac093c79c3de581d306624575eddd7e4e13747e61ba18"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:333c57013ef8c97a53892aa56042831c372e0bb1785ab7026187b7abd0135ad5"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_i686.manylinux2014_i686.whl", hash = "sha256:7f26bc76a133ecb09a38b7868737eded6941b70a6d34ef53a4027e83913b6502"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_ppc64.manylinux2014_ppc64.whl", hash = "sha256:288326162804f34088ac007139488dcb43de590a5ccfec3166396530b58fb89d"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_ppc64.manylinux2014_ppc64.whl", hash = "sha256:01b14b2f72a37390c1b13477c1c02d53184f728be2f3ffc3ace5b44e9e87b90d"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:b12c39b9448632284561cbf4191aa1b005882acbc81900ffa9f9f471c8ff7e26"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_ppc64le.manylinux2014_ppc64le.whl", hash = "sha256:53babd6e63e31f4e96ec95ea0d962298f9f0d9cc5990a1bbb023a6baf2503a82"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:364e6674450cbac8e998f7b30639040c99d81dfb5bbc6dfad69bc7a8f916b3d1"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_s390x.manylinux2014_s390x.whl", hash = "sha256:1ae441ce4cf925b7f363d33cd6570c51435972d697e3e58928973994e56e1452"},
|
||||||
{file = "ruff-0.8.1-py3-none-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:b22346f845fec132aa39cd29acb94451d030c10874408dbf776af3aaeb53284c"},
|
{file = "ruff-0.8.3-py3-none-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:d7c65bc0cadce32255e93c57d57ecc2cca23149edd52714c0c5d6fa11ec328cd"},
|
||||||
{file = "ruff-0.8.1-py3-none-musllinux_1_2_aarch64.whl", hash = "sha256:b2f2f7a7e7648a2bfe6ead4e0a16745db956da0e3a231ad443d2a66a105c04fa"},
|
{file = "ruff-0.8.3-py3-none-musllinux_1_2_aarch64.whl", hash = "sha256:5be450bb18f23f0edc5a4e5585c17a56ba88920d598f04a06bd9fd76d324cb20"},
|
||||||
{file = "ruff-0.8.1-py3-none-musllinux_1_2_armv7l.whl", hash = "sha256:adf314fc458374c25c5c4a4a9270c3e8a6a807b1bec018cfa2813d6546215540"},
|
{file = "ruff-0.8.3-py3-none-musllinux_1_2_armv7l.whl", hash = "sha256:8faeae3827eaa77f5721f09b9472a18c749139c891dbc17f45e72d8f2ca1f8fc"},
|
||||||
{file = "ruff-0.8.1-py3-none-musllinux_1_2_i686.whl", hash = "sha256:a885d68342a231b5ba4d30b8c6e1b1ee3a65cf37e3d29b3c74069cdf1ee1e3c9"},
|
{file = "ruff-0.8.3-py3-none-musllinux_1_2_i686.whl", hash = "sha256:db503486e1cf074b9808403991663e4277f5c664d3fe237ee0d994d1305bb060"},
|
||||||
{file = "ruff-0.8.1-py3-none-musllinux_1_2_x86_64.whl", hash = "sha256:d2c16e3508c8cc73e96aa5127d0df8913d2290098f776416a4b157657bee44c5"},
|
{file = "ruff-0.8.3-py3-none-musllinux_1_2_x86_64.whl", hash = "sha256:6567be9fb62fbd7a099209257fef4ad2c3153b60579818b31a23c886ed4147ea"},
|
||||||
{file = "ruff-0.8.1-py3-none-win32.whl", hash = "sha256:93335cd7c0eaedb44882d75a7acb7df4b77cd7cd0d2255c93b28791716e81790"},
|
{file = "ruff-0.8.3-py3-none-win32.whl", hash = "sha256:19048f2f878f3ee4583fc6cb23fb636e48c2635e30fb2022b3a1cd293402f964"},
|
||||||
{file = "ruff-0.8.1-py3-none-win_amd64.whl", hash = "sha256:2954cdbe8dfd8ab359d4a30cd971b589d335a44d444b6ca2cb3d1da21b75e4b6"},
|
{file = "ruff-0.8.3-py3-none-win_amd64.whl", hash = "sha256:f7df94f57d7418fa7c3ffb650757e0c2b96cf2501a0b192c18e4fb5571dfada9"},
|
||||||
{file = "ruff-0.8.1-py3-none-win_arm64.whl", hash = "sha256:55873cc1a473e5ac129d15eccb3c008c096b94809d693fc7053f588b67822737"},
|
{file = "ruff-0.8.3-py3-none-win_arm64.whl", hash = "sha256:fe2756edf68ea79707c8d68b78ca9a58ed9af22e430430491ee03e718b5e4936"},
|
||||||
{file = "ruff-0.8.1.tar.gz", hash = "sha256:3583db9a6450364ed5ca3f3b4225958b24f78178908d5c4bc0f46251ccca898f"},
|
{file = "ruff-0.8.3.tar.gz", hash = "sha256:5e7558304353b84279042fc584a4f4cb8a07ae79b2bf3da1a7551d960b5626d3"},
|
||||||
]
|
]
|
||||||
|
|
||||||
[[package]]
|
|
||||||
name = "scipy"
|
|
||||||
version = "1.14.1"
|
|
||||||
description = "Fundamental algorithms for scientific computing in Python"
|
|
||||||
optional = false
|
|
||||||
python-versions = ">=3.10"
|
|
||||||
files = [
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-macosx_10_13_x86_64.whl", hash = "sha256:b28d2ca4add7ac16ae8bb6632a3c86e4b9e4d52d3e34267f6e1b0c1f8d87e389"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-macosx_12_0_arm64.whl", hash = "sha256:d0d2821003174de06b69e58cef2316a6622b60ee613121199cb2852a873f8cf3"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-macosx_14_0_arm64.whl", hash = "sha256:8bddf15838ba768bb5f5083c1ea012d64c9a444e16192762bd858f1e126196d0"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-macosx_14_0_x86_64.whl", hash = "sha256:97c5dddd5932bd2a1a31c927ba5e1463a53b87ca96b5c9bdf5dfd6096e27efc3"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:2ff0a7e01e422c15739ecd64432743cf7aae2b03f3084288f399affcefe5222d"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:8e32dced201274bf96899e6491d9ba3e9a5f6b336708656466ad0522d8528f69"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-musllinux_1_2_x86_64.whl", hash = "sha256:8426251ad1e4ad903a4514712d2fa8fdd5382c978010d1c6f5f37ef286a713ad"},
|
|
||||||
{file = "scipy-1.14.1-cp310-cp310-win_amd64.whl", hash = "sha256:a49f6ed96f83966f576b33a44257d869756df6cf1ef4934f59dd58b25e0327e5"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-macosx_10_13_x86_64.whl", hash = "sha256:2da0469a4ef0ecd3693761acbdc20f2fdeafb69e6819cc081308cc978153c675"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-macosx_12_0_arm64.whl", hash = "sha256:c0ee987efa6737242745f347835da2cc5bb9f1b42996a4d97d5c7ff7928cb6f2"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-macosx_14_0_arm64.whl", hash = "sha256:3a1b111fac6baec1c1d92f27e76511c9e7218f1695d61b59e05e0fe04dc59617"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-macosx_14_0_x86_64.whl", hash = "sha256:8475230e55549ab3f207bff11ebfc91c805dc3463ef62eda3ccf593254524ce8"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:278266012eb69f4a720827bdd2dc54b2271c97d84255b2faaa8f161a158c3b37"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:fef8c87f8abfb884dac04e97824b61299880c43f4ce675dd2cbeadd3c9b466d2"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-musllinux_1_2_x86_64.whl", hash = "sha256:b05d43735bb2f07d689f56f7b474788a13ed8adc484a85aa65c0fd931cf9ccd2"},
|
|
||||||
{file = "scipy-1.14.1-cp311-cp311-win_amd64.whl", hash = "sha256:716e389b694c4bb564b4fc0c51bc84d381735e0d39d3f26ec1af2556ec6aad94"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-macosx_10_13_x86_64.whl", hash = "sha256:631f07b3734d34aced009aaf6fedfd0eb3498a97e581c3b1e5f14a04164a456d"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-macosx_12_0_arm64.whl", hash = "sha256:af29a935803cc707ab2ed7791c44288a682f9c8107bc00f0eccc4f92c08d6e07"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-macosx_14_0_arm64.whl", hash = "sha256:2843f2d527d9eebec9a43e6b406fb7266f3af25a751aa91d62ff416f54170bc5"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-macosx_14_0_x86_64.whl", hash = "sha256:eb58ca0abd96911932f688528977858681a59d61a7ce908ffd355957f7025cfc"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:30ac8812c1d2aab7131a79ba62933a2a76f582d5dbbc695192453dae67ad6310"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:8f9ea80f2e65bdaa0b7627fb00cbeb2daf163caa015e59b7516395fe3bd1e066"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-musllinux_1_2_x86_64.whl", hash = "sha256:edaf02b82cd7639db00dbff629995ef185c8df4c3ffa71a5562a595765a06ce1"},
|
|
||||||
{file = "scipy-1.14.1-cp312-cp312-win_amd64.whl", hash = "sha256:2ff38e22128e6c03ff73b6bb0f85f897d2362f8c052e3b8ad00532198fbdae3f"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-macosx_10_13_x86_64.whl", hash = "sha256:1729560c906963fc8389f6aac023739ff3983e727b1a4d87696b7bf108316a79"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-macosx_12_0_arm64.whl", hash = "sha256:4079b90df244709e675cdc8b93bfd8a395d59af40b72e339c2287c91860deb8e"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-macosx_14_0_arm64.whl", hash = "sha256:e0cf28db0f24a38b2a0ca33a85a54852586e43cf6fd876365c86e0657cfe7d73"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-macosx_14_0_x86_64.whl", hash = "sha256:0c2f95de3b04e26f5f3ad5bb05e74ba7f68b837133a4492414b3afd79dfe540e"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-manylinux_2_17_aarch64.manylinux2014_aarch64.whl", hash = "sha256:b99722ea48b7ea25e8e015e8341ae74624f72e5f21fc2abd45f3a93266de4c5d"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl", hash = "sha256:5149e3fd2d686e42144a093b206aef01932a0059c2a33ddfa67f5f035bdfe13e"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-musllinux_1_2_x86_64.whl", hash = "sha256:e4f5a7c49323533f9103d4dacf4e4f07078f360743dec7f7596949149efeec06"},
|
|
||||||
{file = "scipy-1.14.1-cp313-cp313-win_amd64.whl", hash = "sha256:baff393942b550823bfce952bb62270ee17504d02a1801d7fd0719534dfb9c84"},
|
|
||||||
{file = "scipy-1.14.1.tar.gz", hash = "sha256:5a275584e726026a5699459aa72f828a610821006228e841b94275c4a7c08417"},
|
|
||||||
]
|
|
||||||
|
|
||||||
[package.dependencies]
|
|
||||||
numpy = ">=1.23.5,<2.3"
|
|
||||||
|
|
||||||
[package.extras]
|
|
||||||
dev = ["cython-lint (>=0.12.2)", "doit (>=0.36.0)", "mypy (==1.10.0)", "pycodestyle", "pydevtool", "rich-click", "ruff (>=0.0.292)", "types-psutil", "typing_extensions"]
|
|
||||||
doc = ["jupyterlite-pyodide-kernel", "jupyterlite-sphinx (>=0.13.1)", "jupytext", "matplotlib (>=3.5)", "myst-nb", "numpydoc", "pooch", "pydata-sphinx-theme (>=0.15.2)", "sphinx (>=5.0.0,<=7.3.7)", "sphinx-design (>=0.4.0)"]
|
|
||||||
test = ["Cython", "array-api-strict (>=2.0)", "asv", "gmpy2", "hypothesis (>=6.30)", "meson", "mpmath", "ninja", "pooch", "pytest", "pytest-cov", "pytest-timeout", "pytest-xdist", "scikit-umfpack", "threadpoolctl"]
|
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
name = "six"
|
name = "six"
|
||||||
version = "1.16.0"
|
version = "1.17.0"
|
||||||
description = "Python 2 and 3 compatibility utilities"
|
description = "Python 2 and 3 compatibility utilities"
|
||||||
optional = false
|
optional = false
|
||||||
python-versions = ">=2.7, !=3.0.*, !=3.1.*, !=3.2.*"
|
python-versions = "!=3.0.*,!=3.1.*,!=3.2.*,>=2.7"
|
||||||
files = [
|
files = [
|
||||||
{file = "six-1.16.0-py2.py3-none-any.whl", hash = "sha256:8abb2f1d86890a2dfb989f9a77cfcfd3e47c2a354b01111771326f8aa26e0254"},
|
{file = "six-1.17.0-py2.py3-none-any.whl", hash = "sha256:4721f391ed90541fddacab5acf947aa0d3dc7d27b2e1e8eda2be8970586c3274"},
|
||||||
{file = "six-1.16.0.tar.gz", hash = "sha256:1e61c37477a1626458e36f7b1d82aa5c9b094fa4802892072e49de9c60c4c926"},
|
{file = "six-1.17.0.tar.gz", hash = "sha256:ff70335d468e7eb6ec65b95b99d3a2836546063f63acc5171de367e834932a81"},
|
||||||
]
|
]
|
||||||
|
|
||||||
[[package]]
|
[[package]]
|
||||||
@@ -1295,4 +1527,4 @@ files = [
|
|||||||
[metadata]
|
[metadata]
|
||||||
lock-version = "2.0"
|
lock-version = "2.0"
|
||||||
python-versions = "^3.10"
|
python-versions = "^3.10"
|
||||||
content-hash = "c91bc307ff4a5b3e8cd1976ebea211c9749fe09d563dd80861f70ce26826cda9"
|
content-hash = "5b57bccd8dc65a9acecbe187939bae625ef6a259f4188c6587907245bcfa604f"
|
||||||
|
|||||||
@@ -12,10 +12,12 @@ python = "^3.10"
|
|||||||
numpy = "^2.1.3"
|
numpy = "^2.1.3"
|
||||||
tqdm = "^4.67.1"
|
tqdm = "^4.67.1"
|
||||||
parse = "^1.20.2"
|
parse = "^1.20.2"
|
||||||
scipy = "^1.14.1"
|
|
||||||
sympy = "^1.13.3"
|
sympy = "^1.13.3"
|
||||||
networkx = "^3.4.2"
|
networkx = "^3.4.2"
|
||||||
pandas = "^2.2.3"
|
pillow = "^11.0.0"
|
||||||
|
imageio = "^2.36.1"
|
||||||
|
pygifsicle = "^1.1.0"
|
||||||
|
opencv-python = "^4.10.0.84"
|
||||||
|
|
||||||
[tool.poetry.group.dev.dependencies]
|
[tool.poetry.group.dev.dependencies]
|
||||||
pyright = "^1.1.389"
|
pyright = "^1.1.389"
|
||||||
@@ -25,6 +27,13 @@ ipykernel = "^6.29.5"
|
|||||||
networkx-stubs = "^0.0.1"
|
networkx-stubs = "^0.0.1"
|
||||||
types-networkx = "^3.4.2.20241115"
|
types-networkx = "^3.4.2.20241115"
|
||||||
|
|
||||||
|
[tool.poetry.group.cplex.dependencies]
|
||||||
|
docplex = "^2.28.240"
|
||||||
|
cplex = "^22.1.1.2"
|
||||||
|
|
||||||
|
[tool.poetry.group.ortools.dependencies]
|
||||||
|
ortools = "^9.11.4210"
|
||||||
|
|
||||||
[tool.poetry.scripts]
|
[tool.poetry.scripts]
|
||||||
holt59-aoc = "holt59.aoc.__main__:main"
|
holt59-aoc = "holt59.aoc.__main__:main"
|
||||||
|
|
||||||
|
|||||||
@@ -52,7 +52,6 @@ class Solver(BaseSolver):
|
|||||||
m2 += molecule[i]
|
m2 += molecule[i]
|
||||||
i += 1
|
i += 1
|
||||||
|
|
||||||
# print(m2)
|
|
||||||
molecule = m2
|
molecule = m2
|
||||||
|
|
||||||
yield count
|
yield count
|
||||||
|
|||||||
@@ -173,7 +173,6 @@ class Solver(BaseSolver):
|
|||||||
)
|
)
|
||||||
)
|
)
|
||||||
|
|
||||||
# 1242 (not working)
|
|
||||||
yield sum(
|
yield sum(
|
||||||
c
|
c
|
||||||
for _, c in play(
|
for _, c in play(
|
||||||
|
|||||||
107
src/holt59/aoc/2015/day23.py
Normal file
107
src/holt59/aoc/2015/day23.py
Normal file
@@ -0,0 +1,107 @@
|
|||||||
|
import inspect
|
||||||
|
from typing import Any, Callable, Final, Iterator, Mapping
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
|
class Instruction:
|
||||||
|
def __init__(self, fn: Callable[..., None]):
|
||||||
|
self._fn = fn
|
||||||
|
|
||||||
|
args = inspect.getfullargspec(fn)
|
||||||
|
|
||||||
|
self._argtypes = [args.annotations[arg] for arg in args.args[1:]]
|
||||||
|
|
||||||
|
def __call__(self, args: tuple[str, ...]):
|
||||||
|
self._fn(
|
||||||
|
*(argtype(arg) for arg, argtype in zip(args, self._argtypes, strict=True))
|
||||||
|
)
|
||||||
|
|
||||||
|
|
||||||
|
class Machine:
|
||||||
|
def __init__(
|
||||||
|
self, instructions: list[str], registers: dict[str, int] = {"a": 0, "b": 1}
|
||||||
|
):
|
||||||
|
self.instructions: Final = [
|
||||||
|
(part[0], tuple(arg.strip() for arg in " ".join(part[1:]).split(",")))
|
||||||
|
for instruction in instructions
|
||||||
|
if (part := instruction.split())
|
||||||
|
]
|
||||||
|
|
||||||
|
self._fns = {
|
||||||
|
name: Instruction(getattr(self, name))
|
||||||
|
for name in ("hlf", "tpl", "inc", "jmp", "jie", "jio")
|
||||||
|
}
|
||||||
|
|
||||||
|
self._registers = registers.copy()
|
||||||
|
self._ip = 0
|
||||||
|
|
||||||
|
@property
|
||||||
|
def registers(self) -> Mapping[str, int]:
|
||||||
|
return self._registers
|
||||||
|
|
||||||
|
@property
|
||||||
|
def ip(self) -> int:
|
||||||
|
return self._ip
|
||||||
|
|
||||||
|
def reset(self, registers: dict[str, int] = {"a": 0, "b": 0}):
|
||||||
|
self._registers = registers.copy()
|
||||||
|
self._ip = 0
|
||||||
|
|
||||||
|
def hlf(self, register: str):
|
||||||
|
self._registers[register] //= 2
|
||||||
|
self._ip += 1
|
||||||
|
|
||||||
|
def tpl(self, register: str):
|
||||||
|
self._registers[register] *= 3
|
||||||
|
self._ip += 1
|
||||||
|
|
||||||
|
def inc(self, register: str):
|
||||||
|
self._registers[register] += 1
|
||||||
|
self._ip += 1
|
||||||
|
|
||||||
|
def jmp(self, offset: int):
|
||||||
|
self._ip += offset
|
||||||
|
assert 0 <= self._ip < len(self.instructions)
|
||||||
|
|
||||||
|
def jie(self, register: str, offset: int):
|
||||||
|
if self._registers[register] % 2 == 0:
|
||||||
|
self._ip += offset
|
||||||
|
else:
|
||||||
|
self._ip += 1
|
||||||
|
|
||||||
|
def jio(self, register: str, offset: int):
|
||||||
|
if self._registers[register] == 1:
|
||||||
|
self._ip += offset
|
||||||
|
else:
|
||||||
|
self._ip += 1
|
||||||
|
|
||||||
|
def _exec(self) -> bool:
|
||||||
|
# execute next instruction
|
||||||
|
if self._ip >= len(self.instructions):
|
||||||
|
return False
|
||||||
|
|
||||||
|
ins, args = self.instructions[self._ip]
|
||||||
|
|
||||||
|
if ins not in self._fns:
|
||||||
|
return False
|
||||||
|
|
||||||
|
self._fns[ins](args)
|
||||||
|
return True
|
||||||
|
|
||||||
|
def run(self):
|
||||||
|
while self._exec():
|
||||||
|
...
|
||||||
|
return self.registers
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
machine = Machine(input.splitlines())
|
||||||
|
|
||||||
|
registers = machine.run()
|
||||||
|
yield registers["b"]
|
||||||
|
|
||||||
|
machine.reset({"a": 1, "b": 0})
|
||||||
|
registers = machine.run()
|
||||||
|
yield registers["b"]
|
||||||
88
src/holt59/aoc/2015/day24.py
Normal file
88
src/holt59/aoc/2015/day24.py
Normal file
@@ -0,0 +1,88 @@
|
|||||||
|
from typing import Any, Iterator, TypeAlias
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
TupleOfInts: TypeAlias = tuple[int, ...]
|
||||||
|
|
||||||
|
|
||||||
|
def check_n_groups(
|
||||||
|
target: int, groups: tuple[TupleOfInts, ...], numbers: TupleOfInts
|
||||||
|
) -> bool:
|
||||||
|
n_groups = len(groups)
|
||||||
|
groups_s = tuple(sum(group) for group in groups)
|
||||||
|
|
||||||
|
if all(target == group_s for group_s in groups_s):
|
||||||
|
return not numbers
|
||||||
|
|
||||||
|
if not numbers:
|
||||||
|
return False
|
||||||
|
|
||||||
|
head, *tail_l = numbers
|
||||||
|
tail, tail_s = tuple(tail_l), sum(tail_l)
|
||||||
|
|
||||||
|
return any(
|
||||||
|
groups_s[i] + head <= target
|
||||||
|
and sum(groups_s[j] for j in range(len(groups)) if i != j) + tail_s
|
||||||
|
>= (n_groups - 1) * target
|
||||||
|
and check_n_groups(
|
||||||
|
target, groups[:i] + ((groups[i] + (head,)),) + groups[i + 1 :], tail
|
||||||
|
)
|
||||||
|
for i in range(len(groups))
|
||||||
|
)
|
||||||
|
|
||||||
|
|
||||||
|
def enumerate_single_subset(
|
||||||
|
target: int, numbers: TupleOfInts
|
||||||
|
) -> Iterator[tuple[int, TupleOfInts, TupleOfInts]]:
|
||||||
|
"""
|
||||||
|
Enumerate subset of numbers whose sum equals target.
|
||||||
|
|
||||||
|
Subset are enumerated in increasing order of length, then product (quantum value).
|
||||||
|
|
||||||
|
Args:
|
||||||
|
target: Target for the sum of the subset.
|
||||||
|
numbers: Tuple of integers to find the subset from.
|
||||||
|
|
||||||
|
Returns:
|
||||||
|
A generator (quantum, subset, remaining) where subset if the subset of numbers
|
||||||
|
whose sum equals target, quantum the product of the subset, and remaining the
|
||||||
|
remaining numbers.
|
||||||
|
"""
|
||||||
|
groups: list[tuple[int, TupleOfInts, TupleOfInts]] = [(1, (), numbers)]
|
||||||
|
|
||||||
|
for _ in range(len(numbers)):
|
||||||
|
new_groups: list[tuple[int, TupleOfInts, TupleOfInts]] = []
|
||||||
|
|
||||||
|
for g_quantum, group, remaining in groups:
|
||||||
|
sg = sum(group)
|
||||||
|
for i in range(len(remaining)):
|
||||||
|
if group and remaining[i] <= group[-1]:
|
||||||
|
continue
|
||||||
|
|
||||||
|
uv = remaining[:i] + remaining[i + 1 :]
|
||||||
|
kv = g_quantum * remaining[i], group + (remaining[i],), uv
|
||||||
|
|
||||||
|
if sg + remaining[i] == target:
|
||||||
|
yield kv
|
||||||
|
elif sg + remaining[i] < target:
|
||||||
|
new_groups.append(kv)
|
||||||
|
|
||||||
|
groups = new_groups
|
||||||
|
|
||||||
|
|
||||||
|
def find_min_quantum(numbers: tuple[int, ...], n_groups: int):
|
||||||
|
return next(
|
||||||
|
g_quantum
|
||||||
|
for g_quantum, group_1v2, group_234v2 in enumerate_single_subset(
|
||||||
|
sum(numbers) // n_groups, numbers
|
||||||
|
)
|
||||||
|
if check_n_groups(sum(group_1v2), ((),) * (n_groups - 1), group_234v2)
|
||||||
|
)
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
numbers = tuple(map(int, input.split()))
|
||||||
|
|
||||||
|
yield find_min_quantum(numbers, 3)
|
||||||
|
yield find_min_quantum(numbers, 4)
|
||||||
16
src/holt59/aoc/2015/day25.py
Normal file
16
src/holt59/aoc/2015/day25.py
Normal file
@@ -0,0 +1,16 @@
|
|||||||
|
import re
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
from ..tools.math import pow_mod
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
m = re.search(r"row\s*([0-9]+)\s*,\s*column\s*([0-9]+)", input)
|
||||||
|
assert m is not None
|
||||||
|
|
||||||
|
row, col = int(m.group(1)), int(m.group(2))
|
||||||
|
n = (row * (row - 1)) // 2 + col * (col + 1) // 2 + (row - 1) * (col - 1)
|
||||||
|
|
||||||
|
yield (20151125 * pow_mod(252533, n - 1, 33554393)) % 33554393
|
||||||
@@ -1,14 +1,17 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
values = [int(line) for line in lines]
|
|
||||||
|
|
||||||
# part 1
|
class Solver(BaseSolver):
|
||||||
answer_1 = sum(v2 > v1 for v1, v2 in zip(values[:-1], values[1:]))
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
print(f"answer 1 is {answer_1}")
|
lines = input.splitlines()
|
||||||
|
|
||||||
# part 2
|
values = [int(line) for line in lines]
|
||||||
runnings = [sum(values[i : i + 3]) for i in range(len(values) - 2)]
|
|
||||||
answer_2 = sum(v2 > v1 for v1, v2 in zip(runnings[:-1], runnings[1:]))
|
# part 1
|
||||||
print(f"answer 2 is {answer_2}")
|
yield sum(v2 > v1 for v1, v2 in zip(values[:-1], values[1:]))
|
||||||
|
|
||||||
|
# part 2
|
||||||
|
runnings = [sum(values[i : i + 3]) for i in range(len(values) - 2)]
|
||||||
|
yield sum(v2 > v1 for v1, v2 in zip(runnings[:-1], runnings[1:]))
|
||||||
|
|||||||
@@ -1,11 +1,47 @@
|
|||||||
import sys
|
from functools import reduce
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
BRACKETS = {"{": "}", "[": "]", "<": ">", "(": ")"}
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
CORRUPT_SCORES = {")": 3, "]": 57, "}": 1197, ">": 25137}
|
||||||
answer_2 = ...
|
COMPLETE_SCORES = {")": 1, "]": 2, "}": 3, ">": 4}
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|
||||||
|
def corrupted_or_incomplete(line: str) -> tuple[bool, str]:
|
||||||
|
opens: list[str] = []
|
||||||
|
|
||||||
|
for c in line:
|
||||||
|
if c in BRACKETS:
|
||||||
|
opens.append(c)
|
||||||
|
elif BRACKETS[opens[-1]] != c:
|
||||||
|
return True, c
|
||||||
|
else:
|
||||||
|
opens.pop()
|
||||||
|
|
||||||
|
return (False, "".join(opens))
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
|
answer_1: int = 0
|
||||||
|
incomplete_scores: list[int] = []
|
||||||
|
|
||||||
|
for line in lines:
|
||||||
|
c, r = corrupted_or_incomplete(line)
|
||||||
|
if c:
|
||||||
|
answer_1 += CORRUPT_SCORES[r]
|
||||||
|
else:
|
||||||
|
incomplete_scores.append(
|
||||||
|
reduce(
|
||||||
|
lambda s, c: s * 5 + COMPLETE_SCORES[BRACKETS[c]],
|
||||||
|
reversed(r),
|
||||||
|
0,
|
||||||
|
),
|
||||||
|
)
|
||||||
|
|
||||||
|
yield answer_1
|
||||||
|
yield sorted(incomplete_scores)[len(incomplete_scores) // 2]
|
||||||
|
|||||||
@@ -1,11 +1,66 @@
|
|||||||
import sys
|
import itertools as it
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
def do_step(values: list[list[int]]) -> tuple[list[list[int]], set[tuple[int, int]]]:
|
||||||
answer_2 = ...
|
values = [[c + 1 for c in r] for r in values]
|
||||||
print(f"answer 2 is {answer_2}")
|
flashed: set[tuple[int, int]] = set()
|
||||||
|
|
||||||
|
while True:
|
||||||
|
found = False
|
||||||
|
|
||||||
|
for i_row, row in enumerate(values):
|
||||||
|
for i_col, col in enumerate(row):
|
||||||
|
if col <= 9 or (i_row, i_col) in flashed:
|
||||||
|
continue
|
||||||
|
|
||||||
|
found = True
|
||||||
|
flashed.add((i_row, i_col))
|
||||||
|
for dr, dc in it.product((-1, 0, 1), repeat=2):
|
||||||
|
if 0 <= i_row + dr < len(values) and 0 <= i_col + dc < len(
|
||||||
|
values[0]
|
||||||
|
):
|
||||||
|
values[i_row + dr][i_col + dc] += 1
|
||||||
|
|
||||||
|
if not found:
|
||||||
|
break
|
||||||
|
|
||||||
|
for i, j in flashed:
|
||||||
|
values[i][j] = 0
|
||||||
|
|
||||||
|
return values, flashed
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def print_grid(self, values: list[list[int]], flashed: set[tuple[int, int]]):
|
||||||
|
for i_row, row in enumerate(values):
|
||||||
|
s_row = ""
|
||||||
|
for i_col, col in enumerate(row):
|
||||||
|
if (i_row, i_col) in flashed:
|
||||||
|
s_row += f"\033[0;31m{col}\033[0;00m"
|
||||||
|
else:
|
||||||
|
s_row += str(col)
|
||||||
|
self.logger.info(s_row)
|
||||||
|
self.logger.info("")
|
||||||
|
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
values_0 = [[int(c) for c in r] for r in input.splitlines()]
|
||||||
|
|
||||||
|
values = values_0
|
||||||
|
total_flashed: int = 0
|
||||||
|
for _ in range(100):
|
||||||
|
values, flashed = do_step(values)
|
||||||
|
total_flashed += len(flashed)
|
||||||
|
|
||||||
|
yield total_flashed
|
||||||
|
|
||||||
|
n_cells = len(values) * len(values[0])
|
||||||
|
flashed: set[tuple[int, int]] = set()
|
||||||
|
values, step = values_0, 0
|
||||||
|
while len(flashed) != n_cells:
|
||||||
|
values, flashed = do_step(values)
|
||||||
|
step += 1
|
||||||
|
|
||||||
|
yield step
|
||||||
|
|||||||
@@ -1,11 +1,64 @@
|
|||||||
import sys
|
import string
|
||||||
|
from collections import defaultdict
|
||||||
|
from functools import cache
|
||||||
|
from typing import Any, Iterator, Mapping, Sequence
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
@cache
|
||||||
answer_2 = ...
|
def is_small(node: str):
|
||||||
print(f"answer 2 is {answer_2}")
|
return all(c in string.ascii_lowercase for c in node)
|
||||||
|
|
||||||
|
|
||||||
|
def enumerate_paths(
|
||||||
|
neighbors: Mapping[str, Sequence[str]],
|
||||||
|
duplicate_smalls: int = 0,
|
||||||
|
start: str = "start",
|
||||||
|
current: tuple[str, ...] = ("start",),
|
||||||
|
) -> Iterator[tuple[str, ...]]:
|
||||||
|
if start == "end":
|
||||||
|
yield current
|
||||||
|
|
||||||
|
for neighbor in neighbors[start]:
|
||||||
|
if not is_small(neighbor):
|
||||||
|
yield from enumerate_paths(
|
||||||
|
neighbors, duplicate_smalls, neighbor, current + (neighbor,)
|
||||||
|
)
|
||||||
|
elif neighbor not in current:
|
||||||
|
yield from enumerate_paths(
|
||||||
|
neighbors, duplicate_smalls, neighbor, current + (neighbor,)
|
||||||
|
)
|
||||||
|
elif duplicate_smalls > 0:
|
||||||
|
yield from enumerate_paths(
|
||||||
|
neighbors, duplicate_smalls - 1, neighbor, current + (neighbor,)
|
||||||
|
)
|
||||||
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
neighbors: dict[str, list[str]] = defaultdict(list)
|
||||||
|
|
||||||
|
for row in input.splitlines():
|
||||||
|
a, b = row.split("-")
|
||||||
|
if a != "end" and b != "start":
|
||||||
|
neighbors[a].append(b)
|
||||||
|
if b != "end" and a != "start":
|
||||||
|
neighbors[b].append(a)
|
||||||
|
|
||||||
|
if self.files:
|
||||||
|
graph = "graph {\n"
|
||||||
|
for node, neighbors_of in neighbors.items():
|
||||||
|
graph += (
|
||||||
|
" ".join(
|
||||||
|
f"{node} -- {neighbor};"
|
||||||
|
for neighbor in neighbors_of
|
||||||
|
if node <= neighbor or node == "start" or neighbor == "end"
|
||||||
|
)
|
||||||
|
+ "\n"
|
||||||
|
)
|
||||||
|
graph += "}\n"
|
||||||
|
self.files.create("graph.dot", graph.encode(), False)
|
||||||
|
|
||||||
|
yield len(list(enumerate_paths(neighbors)))
|
||||||
|
yield len(list(enumerate_paths(neighbors, 1)))
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,41 +1,38 @@
|
|||||||
import sys
|
|
||||||
from math import prod
|
from math import prod
|
||||||
from typing import Literal, TypeAlias, cast
|
from typing import Any, Iterator, Literal, TypeAlias, cast
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
Command: TypeAlias = Literal["forward", "up", "down"]
|
Command: TypeAlias = Literal["forward", "up", "down"]
|
||||||
|
|
||||||
commands: list[tuple[Command, int]] = [
|
|
||||||
(cast(Command, (p := line.split())[0]), int(p[1])) for line in lines
|
|
||||||
]
|
|
||||||
|
|
||||||
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
def depth_and_position(use_aim: bool):
|
commands: list[tuple[Command, int]] = [
|
||||||
aim, pos, depth = 0, 0, 0
|
(cast(Command, (p := line.split())[0]), int(p[1])) for line in lines
|
||||||
for command, value in commands:
|
]
|
||||||
d_depth = 0
|
|
||||||
match command:
|
|
||||||
case "forward":
|
|
||||||
pos += value
|
|
||||||
depth += value * aim
|
|
||||||
case "up":
|
|
||||||
d_depth = -value
|
|
||||||
case "down":
|
|
||||||
d_depth = value
|
|
||||||
|
|
||||||
if use_aim:
|
def depth_and_position(use_aim: bool):
|
||||||
aim += d_depth
|
aim, pos, depth = 0, 0, 0
|
||||||
else:
|
for command, value in commands:
|
||||||
depth += value
|
d_depth = 0
|
||||||
|
match command:
|
||||||
|
case "forward":
|
||||||
|
pos += value
|
||||||
|
depth += value * aim
|
||||||
|
case "up":
|
||||||
|
d_depth = -value
|
||||||
|
case "down":
|
||||||
|
d_depth = value
|
||||||
|
|
||||||
return depth, pos
|
if use_aim:
|
||||||
|
aim += d_depth
|
||||||
|
else:
|
||||||
|
depth += value
|
||||||
|
|
||||||
|
return depth, pos
|
||||||
|
|
||||||
# part 1
|
yield prod(depth_and_position(False))
|
||||||
answer_1 = prod(depth_and_position(False))
|
yield prod(depth_and_position(True))
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
|
||||||
answer_2 = prod(depth_and_position(True))
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,11 +1,7 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# part 1
|
|
||||||
answer_1 = ...
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
class Solver(BaseSolver):
|
||||||
answer_2 = ...
|
def solve(self, input: str) -> Iterator[Any]: ...
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,6 +1,7 @@
|
|||||||
import sys
|
|
||||||
from collections import Counter
|
from collections import Counter
|
||||||
from typing import Literal
|
from typing import Any, Iterator, Literal
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def generator_rating(
|
def generator_rating(
|
||||||
@@ -20,20 +21,23 @@ def generator_rating(
|
|||||||
return values[0]
|
return values[0]
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
|
# part 1
|
||||||
|
most_and_least_common = [
|
||||||
|
tuple(
|
||||||
|
Counter(line[col] for line in lines).most_common(2)[m][0]
|
||||||
|
for m in range(2)
|
||||||
|
)
|
||||||
|
for col in range(len(lines[0]))
|
||||||
|
]
|
||||||
|
gamma_rate = int("".join(most for most, _ in most_and_least_common), base=2)
|
||||||
|
epsilon_rate = int("".join(least for _, least in most_and_least_common), base=2)
|
||||||
|
yield gamma_rate * epsilon_rate
|
||||||
|
|
||||||
# part 1
|
# part 2
|
||||||
most_and_least_common = [
|
oxygen_generator_rating = int(generator_rating(lines, True, "1"), base=2)
|
||||||
tuple(Counter(line[col] for line in lines).most_common(2)[m][0] for m in range(2))
|
co2_scrubber_rating = int(generator_rating(lines, False, "0"), base=2)
|
||||||
for col in range(len(lines[0]))
|
yield oxygen_generator_rating * co2_scrubber_rating
|
||||||
]
|
|
||||||
gamma_rate = int("".join(most for most, _ in most_and_least_common), base=2)
|
|
||||||
epsilon_rate = int("".join(least for _, least in most_and_least_common), base=2)
|
|
||||||
print(f"answer 1 is {gamma_rate * epsilon_rate}")
|
|
||||||
|
|
||||||
# part 2
|
|
||||||
oxygen_generator_rating = int(generator_rating(lines, True, "1"), base=2)
|
|
||||||
co2_scrubber_rating = int(generator_rating(lines, False, "0"), base=2)
|
|
||||||
answer_2 = oxygen_generator_rating * co2_scrubber_rating
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,45 +1,52 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
numbers = [int(c) for c in lines[0].split(",")]
|
|
||||||
|
|
||||||
boards = np.asarray(
|
class Solver(BaseSolver):
|
||||||
[
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
[[int(c) for c in line.split()] for line in lines[start : start + 5]]
|
lines = input.splitlines()
|
||||||
for start in range(2, len(lines), 6)
|
|
||||||
]
|
|
||||||
)
|
|
||||||
|
|
||||||
# (round, score) for each board (-1 when not found)
|
numbers = [int(c) for c in lines[0].split(",")]
|
||||||
winning_rounds: list[tuple[int, int]] = [(-1, -1) for _ in range(len(boards))]
|
|
||||||
marked = np.zeros_like(boards, dtype=bool)
|
|
||||||
|
|
||||||
for round, number in enumerate(numbers):
|
boards = np.asarray(
|
||||||
# mark boards
|
[
|
||||||
marked[boards == number] = True
|
[[int(c) for c in line.split()] for line in lines[start : start + 5]]
|
||||||
|
for start in range(2, len(lines), 6)
|
||||||
|
]
|
||||||
|
)
|
||||||
|
|
||||||
# check each board for winning
|
# (round, score) for each board (-1 when not found)
|
||||||
for index in range(len(boards)):
|
winning_rounds: list[tuple[int, int]] = [(-1, -1) for _ in range(len(boards))]
|
||||||
if winning_rounds[index][0] > 0:
|
marked = np.zeros_like(boards, dtype=bool)
|
||||||
continue
|
|
||||||
|
|
||||||
if np.any(np.all(marked[index], axis=0) | np.all(marked[index], axis=1)):
|
for round, number in enumerate(numbers):
|
||||||
winning_rounds[index] = (
|
# mark boards
|
||||||
round,
|
marked[boards == number] = True
|
||||||
number * int(np.sum(boards[index][~marked[index]])),
|
|
||||||
)
|
|
||||||
|
|
||||||
# all boards are winning - break
|
# check each board for winning
|
||||||
if np.all(marked.all(axis=1) | marked.all(axis=2)):
|
for index in range(len(boards)):
|
||||||
break
|
if winning_rounds[index][0] > 0:
|
||||||
|
continue
|
||||||
|
|
||||||
# part 1
|
if np.any(
|
||||||
(_, score) = min(winning_rounds, key=lambda w: w[0])
|
np.all(marked[index], axis=0) | np.all(marked[index], axis=1)
|
||||||
print(f"answer 1 is {score}")
|
):
|
||||||
|
winning_rounds[index] = (
|
||||||
|
round,
|
||||||
|
number * int(np.sum(boards[index][~marked[index]])),
|
||||||
|
)
|
||||||
|
|
||||||
# part 2
|
# all boards are winning - break
|
||||||
(_, score) = max(winning_rounds, key=lambda w: w[0])
|
if np.all(marked.all(axis=1) | marked.all(axis=2)):
|
||||||
print(f"answer 2 is {score}")
|
break
|
||||||
|
|
||||||
|
# part 1
|
||||||
|
(_, score) = min(winning_rounds, key=lambda w: w[0])
|
||||||
|
yield score
|
||||||
|
|
||||||
|
# part 2
|
||||||
|
(_, score) = max(winning_rounds, key=lambda w: w[0])
|
||||||
|
yield score
|
||||||
|
|||||||
@@ -1,48 +1,48 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
|
||||||
lines: list[str] = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
sections: list[tuple[tuple[int, int], tuple[int, int]]] = [
|
|
||||||
(
|
|
||||||
(
|
|
||||||
int(line.split(" -> ")[0].split(",")[0]),
|
|
||||||
int(line.split(" -> ")[0].split(",")[1]),
|
|
||||||
),
|
|
||||||
(
|
|
||||||
int(line.split(" -> ")[1].split(",")[0]),
|
|
||||||
int(line.split(" -> ")[1].split(",")[1]),
|
|
||||||
),
|
|
||||||
)
|
|
||||||
for line in lines
|
|
||||||
]
|
|
||||||
|
|
||||||
np_sections = np.array(sections).reshape(-1, 4)
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
x_min, x_max, y_min, y_max = (
|
sections: list[tuple[tuple[int, int], tuple[int, int]]] = [
|
||||||
min(np_sections[:, 0].min(), np_sections[:, 2].min()),
|
(
|
||||||
max(np_sections[:, 0].max(), np_sections[:, 2].max()),
|
(
|
||||||
min(np_sections[:, 1].min(), np_sections[:, 3].min()),
|
int(line.split(" -> ")[0].split(",")[0]),
|
||||||
max(np_sections[:, 1].max(), np_sections[:, 3].max()),
|
int(line.split(" -> ")[0].split(",")[1]),
|
||||||
)
|
),
|
||||||
|
(
|
||||||
|
int(line.split(" -> ")[1].split(",")[0]),
|
||||||
|
int(line.split(" -> ")[1].split(",")[1]),
|
||||||
|
),
|
||||||
|
)
|
||||||
|
for line in lines
|
||||||
|
]
|
||||||
|
|
||||||
counts_1 = np.zeros((y_max + 1, x_max + 1), dtype=int)
|
np_sections = np.array(sections).reshape(-1, 4)
|
||||||
counts_2 = counts_1.copy()
|
|
||||||
|
|
||||||
for (x1, y1), (x2, y2) in sections:
|
x_max, y_max = (
|
||||||
x_rng = range(x1, x2 + 1, 1) if x2 >= x1 else range(x1, x2 - 1, -1)
|
max(np_sections[:, 0].max(), np_sections[:, 2].max()),
|
||||||
y_rng = range(y1, y2 + 1, 1) if y2 >= y1 else range(y1, y2 - 1, -1)
|
max(np_sections[:, 1].max(), np_sections[:, 3].max()),
|
||||||
|
)
|
||||||
|
|
||||||
if x1 == x2 or y1 == y2:
|
counts_1 = np.zeros((y_max + 1, x_max + 1), dtype=int)
|
||||||
counts_1[list(y_rng), list(x_rng)] += 1
|
counts_2 = counts_1.copy()
|
||||||
counts_2[list(y_rng), list(x_rng)] += 1
|
|
||||||
elif abs(x2 - x1) == abs(y2 - y1):
|
|
||||||
for i, j in zip(y_rng, x_rng):
|
|
||||||
counts_2[i, j] += 1
|
|
||||||
|
|
||||||
answer_1 = (counts_1 >= 2).sum()
|
for (x1, y1), (x2, y2) in sections:
|
||||||
print(f"answer 1 is {answer_1}")
|
x_rng = range(x1, x2 + 1, 1) if x2 >= x1 else range(x1, x2 - 1, -1)
|
||||||
|
y_rng = range(y1, y2 + 1, 1) if y2 >= y1 else range(y1, y2 - 1, -1)
|
||||||
|
|
||||||
answer_2 = (counts_2 >= 2).sum()
|
if x1 == x2 or y1 == y2:
|
||||||
print(f"answer 2 is {answer_2}")
|
counts_1[list(y_rng), list(x_rng)] += 1
|
||||||
|
counts_2[list(y_rng), list(x_rng)] += 1
|
||||||
|
elif abs(x2 - x1) == abs(y2 - y1):
|
||||||
|
for i, j in zip(y_rng, x_rng):
|
||||||
|
counts_2[i, j] += 1
|
||||||
|
|
||||||
|
yield (counts_1 >= 2).sum()
|
||||||
|
yield (counts_2 >= 2).sum()
|
||||||
|
|||||||
@@ -1,21 +1,21 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
values = [int(c) for c in sys.stdin.read().strip().split(",")]
|
from ..base import BaseSolver
|
||||||
|
|
||||||
days = 256
|
|
||||||
lanterns = {day: 0 for day in range(days)}
|
|
||||||
for value in values:
|
|
||||||
for day in range(value, days, 7):
|
|
||||||
lanterns[day] += 1
|
|
||||||
|
|
||||||
for day in range(days):
|
class Solver(BaseSolver):
|
||||||
for day2 in range(day + 9, days, 7):
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
lanterns[day2] += lanterns[day]
|
values = [int(c) for c in input.split(",")]
|
||||||
|
|
||||||
# part 1
|
days = 256
|
||||||
answer_1 = sum(v for k, v in lanterns.items() if k < 80) + len(values)
|
lanterns = {day: 0 for day in range(days)}
|
||||||
print(f"answer 1 is {answer_1}")
|
for value in values:
|
||||||
|
for day in range(value, days, 7):
|
||||||
|
lanterns[day] += 1
|
||||||
|
|
||||||
# part 2
|
for day in range(days):
|
||||||
answer_2 = sum(lanterns.values()) + len(values)
|
for day2 in range(day + 9, days, 7):
|
||||||
print(f"answer 2 is {answer_2}")
|
lanterns[day2] += lanterns[day]
|
||||||
|
|
||||||
|
yield sum(v for k, v in lanterns.items() if k < 80) + len(values)
|
||||||
|
yield sum(lanterns.values()) + len(values)
|
||||||
|
|||||||
@@ -1,19 +1,22 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
positions = [int(c) for c in sys.stdin.read().strip().split(",")]
|
from ..base import BaseSolver
|
||||||
|
|
||||||
min_position, max_position = min(positions), max(positions)
|
|
||||||
|
|
||||||
# part 1
|
class Solver(BaseSolver):
|
||||||
answer_1 = min(
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
sum(abs(p - position) for p in positions)
|
positions = [int(c) for c in input.split(",")]
|
||||||
for position in range(min_position, max_position + 1)
|
|
||||||
)
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
min_position, max_position = min(positions), max(positions)
|
||||||
answer_2 = min(
|
|
||||||
sum(abs(p - position) * (abs(p - position) + 1) // 2 for p in positions)
|
# part 1
|
||||||
for position in range(min_position, max_position + 1)
|
yield min(
|
||||||
)
|
sum(abs(p - position) for p in positions)
|
||||||
print(f"answer 2 is {answer_2}")
|
for position in range(min_position, max_position + 1)
|
||||||
|
)
|
||||||
|
|
||||||
|
# part 2
|
||||||
|
yield min(
|
||||||
|
sum(abs(p - position) * (abs(p - position) + 1) // 2 for p in positions)
|
||||||
|
for position in range(min_position, max_position + 1)
|
||||||
|
)
|
||||||
|
|||||||
@@ -1,8 +1,7 @@
|
|||||||
import itertools
|
import itertools
|
||||||
import os
|
from typing import Any, Iterator
|
||||||
import sys
|
|
||||||
|
|
||||||
VERBOSE = os.getenv("AOC_VERBOSE") == "True"
|
from ..base import BaseSolver
|
||||||
|
|
||||||
digits = {
|
digits = {
|
||||||
"abcefg": 0,
|
"abcefg": 0,
|
||||||
@@ -17,71 +16,74 @@ digits = {
|
|||||||
"abcdfg": 9,
|
"abcdfg": 9,
|
||||||
}
|
}
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
|
||||||
|
|
||||||
# part 1
|
class Solver(BaseSolver):
|
||||||
lengths = {len(k) for k, v in digits.items() if v in (1, 4, 7, 8)}
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
answer_1 = sum(
|
lines = input.splitlines()
|
||||||
len(p) in lengths for line in lines for p in line.split("|")[1].strip().split()
|
|
||||||
)
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
# part 1
|
||||||
values: list[int] = []
|
lengths = {len(k) for k, v in digits.items() if v in (1, 4, 7, 8)}
|
||||||
|
yield sum(
|
||||||
|
len(p) in lengths
|
||||||
|
for line in lines
|
||||||
|
for p in line.split("|")[1].strip().split()
|
||||||
|
)
|
||||||
|
|
||||||
for line in lines:
|
# part 2
|
||||||
parts = line.split("|")
|
values: list[int] = []
|
||||||
broken_digits = sorted(parts[0].strip().split(), key=len)
|
|
||||||
|
|
||||||
per_length = {
|
for line in lines:
|
||||||
k: list(v)
|
parts = line.split("|")
|
||||||
for k, v in itertools.groupby(sorted(broken_digits, key=len), key=len)
|
broken_digits = sorted(parts[0].strip().split(), key=len)
|
||||||
}
|
|
||||||
|
|
||||||
# a can be found immediately
|
per_length = {
|
||||||
a = next(u for u in per_length[3][0] if u not in per_length[2][0])
|
k: list(v)
|
||||||
|
for k, v in itertools.groupby(sorted(broken_digits, key=len), key=len)
|
||||||
|
}
|
||||||
|
|
||||||
# c and f have only two possible values corresponding to the single entry of
|
# a can be found immediately
|
||||||
# length 2
|
a = next(u for u in per_length[3][0] if u not in per_length[2][0])
|
||||||
cf = list(per_length[2][0])
|
|
||||||
|
|
||||||
# the only digit of length 4 contains bcdf, so we can deduce bd by removing cf
|
# c and f have only two possible values corresponding to the single entry of
|
||||||
bd = [u for u in per_length[4][0] if u not in cf]
|
# length 2
|
||||||
|
cf = list(per_length[2][0])
|
||||||
|
|
||||||
# the 3 digits of length 5 have a, d and g in common
|
# the only digit of length 4 contains bcdf, so we can deduce bd by removing cf
|
||||||
adg = [u for u in per_length[5][0] if all(u in pe for pe in per_length[5][1:])]
|
bd = [u for u in per_length[4][0] if u not in cf]
|
||||||
|
|
||||||
# we can remove a
|
# the 3 digits of length 5 have a, d and g in common
|
||||||
dg = [u for u in adg if u != a]
|
adg = [
|
||||||
|
u for u in per_length[5][0] if all(u in pe for pe in per_length[5][1:])
|
||||||
|
]
|
||||||
|
|
||||||
# we can deduce d and g
|
# we can remove a
|
||||||
d = next(u for u in dg if u in bd)
|
dg = [u for u in adg if u != a]
|
||||||
g = next(u for u in dg if u != d)
|
|
||||||
|
|
||||||
# then b
|
# we can deduce d and g
|
||||||
b = next(u for u in bd if u != d)
|
d = next(u for u in dg if u in bd)
|
||||||
|
g = next(u for u in dg if u != d)
|
||||||
|
|
||||||
# f is in the three 6-length digits, while c is only in 2
|
# then b
|
||||||
f = next(u for u in cf if all(u in p for p in per_length[6]))
|
b = next(u for u in bd if u != d)
|
||||||
|
|
||||||
# c is not f
|
# f is in the three 6-length digits, while c is only in 2
|
||||||
c = next(u for u in cf if u != f)
|
f = next(u for u in cf if all(u in p for p in per_length[6]))
|
||||||
|
|
||||||
# e is the last one
|
# c is not f
|
||||||
e = next(u for u in "abcdefg" if u not in {a, b, c, d, f, g})
|
c = next(u for u in cf if u != f)
|
||||||
|
|
||||||
mapping = dict(zip((a, b, c, d, e, f, g), "abcdefg"))
|
# e is the last one
|
||||||
|
e = next(u for u in "abcdefg" if u not in {a, b, c, d, f, g})
|
||||||
|
|
||||||
value = 0
|
mapping = dict(zip((a, b, c, d, e, f, g), "abcdefg"))
|
||||||
for number in parts[1].strip().split():
|
|
||||||
digit = "".join(sorted(mapping[c] for c in number))
|
|
||||||
value = 10 * value + digits[digit]
|
|
||||||
|
|
||||||
if VERBOSE:
|
value = 0
|
||||||
print(value)
|
for number in parts[1].strip().split():
|
||||||
|
digit = "".join(sorted(mapping[c] for c in number))
|
||||||
|
value = 10 * value + digits[digit]
|
||||||
|
|
||||||
values.append(value)
|
self.logger.info(f"value for '{line}' is {value}")
|
||||||
|
|
||||||
|
values.append(value)
|
||||||
|
|
||||||
answer_2 = sum(values)
|
yield sum(values)
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,18 +1,18 @@
|
|||||||
import sys
|
|
||||||
from math import prod
|
from math import prod
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
values = [[int(c) for c in row] for row in sys.stdin.read().splitlines()]
|
from ..base import BaseSolver
|
||||||
n_rows, n_cols = len(values), len(values[0])
|
|
||||||
|
|
||||||
|
|
||||||
def neighbors(point: tuple[int, int]):
|
def neighbors(point: tuple[int, int], n_rows: int, n_cols: int):
|
||||||
i, j = point
|
i, j = point
|
||||||
for di, dj in ((-1, 0), (+1, 0), (0, -1), (0, +1)):
|
for di, dj in ((-1, 0), (+1, 0), (0, -1), (0, +1)):
|
||||||
if 0 <= i + di < n_rows and 0 <= j + dj < n_cols:
|
if 0 <= i + di < n_rows and 0 <= j + dj < n_cols:
|
||||||
yield (i + di, j + dj)
|
yield (i + di, j + dj)
|
||||||
|
|
||||||
|
|
||||||
def basin(start: tuple[int, int]) -> set[tuple[int, int]]:
|
def basin(values: list[list[int]], start: tuple[int, int]) -> set[tuple[int, int]]:
|
||||||
|
n_rows, n_cols = len(values), len(values[0])
|
||||||
visited: set[tuple[int, int]] = set()
|
visited: set[tuple[int, int]] = set()
|
||||||
queue = [start]
|
queue = [start]
|
||||||
|
|
||||||
@@ -23,22 +23,25 @@ def basin(start: tuple[int, int]) -> set[tuple[int, int]]:
|
|||||||
continue
|
continue
|
||||||
|
|
||||||
visited.add((i, j))
|
visited.add((i, j))
|
||||||
queue.extend(neighbors((i, j)))
|
queue.extend(neighbors((i, j), n_rows, n_cols))
|
||||||
|
|
||||||
return visited
|
return visited
|
||||||
|
|
||||||
|
|
||||||
low_points = [
|
class Solver(BaseSolver):
|
||||||
(i, j)
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
for i in range(n_rows)
|
values = [[int(c) for c in row] for row in input.splitlines()]
|
||||||
for j in range(n_cols)
|
n_rows, n_cols = len(values), len(values[0])
|
||||||
if all(values[ti][tj] > values[i][j] for ti, tj in neighbors((i, j)))
|
|
||||||
]
|
|
||||||
|
|
||||||
# part 1
|
low_points = [
|
||||||
answer_1 = sum(values[i][j] + 1 for i, j in low_points)
|
(i, j)
|
||||||
print(f"answer 1 is {answer_1}")
|
for i in range(n_rows)
|
||||||
|
for j in range(n_cols)
|
||||||
|
if all(
|
||||||
|
values[ti][tj] > values[i][j]
|
||||||
|
for ti, tj in neighbors((i, j), n_rows, n_cols)
|
||||||
|
)
|
||||||
|
]
|
||||||
|
|
||||||
# part 2
|
yield sum(values[i][j] + 1 for i, j in low_points)
|
||||||
answer_2 = prod(sorted(len(basin(point)) for point in low_points)[-3:])
|
yield prod(sorted(len(basin(values, point)) for point in low_points)[-3:])
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,7 +1,12 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
blocks = sys.stdin.read().split("\n\n")
|
from ..base import BaseSolver
|
||||||
values = sorted(sum(map(int, block.split())) for block in blocks)
|
|
||||||
|
|
||||||
print(f"answer 1 is {values[-1]}")
|
|
||||||
print(f"answer 2 is {sum(values[-3:])}")
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
blocks = input.split("\n\n")
|
||||||
|
values = sorted(sum(map(int, block.split())) for block in blocks)
|
||||||
|
|
||||||
|
yield values[-1]
|
||||||
|
yield sum(values[-3:])
|
||||||
|
|||||||
@@ -1,38 +1,43 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
cycle = 1
|
|
||||||
x = 1
|
|
||||||
|
|
||||||
values = {cycle: x}
|
|
||||||
|
|
||||||
for line in lines:
|
|
||||||
cycle += 1
|
|
||||||
|
|
||||||
if line == "noop":
|
|
||||||
pass
|
|
||||||
else:
|
|
||||||
r = int(line.split()[1])
|
|
||||||
|
|
||||||
values[cycle] = x
|
|
||||||
|
|
||||||
cycle += 1
|
|
||||||
x += r
|
|
||||||
|
|
||||||
values[cycle] = x
|
|
||||||
|
|
||||||
answer_1 = sum(c * values[c] for c in range(20, max(values.keys()) + 1, 40))
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
|
|
||||||
for i in range(6):
|
class Solver(BaseSolver):
|
||||||
for j in range(40):
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
v = values[1 + i * 40 + j]
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
if j >= v - 1 and j <= v + 1:
|
cycle, x = 1, 1
|
||||||
print("#", end="")
|
values = {cycle: x}
|
||||||
else:
|
|
||||||
print(".", end="")
|
|
||||||
|
|
||||||
print()
|
for line in lines:
|
||||||
|
cycle += 1
|
||||||
|
|
||||||
|
if line == "noop":
|
||||||
|
pass
|
||||||
|
else:
|
||||||
|
r = int(line.split()[1])
|
||||||
|
|
||||||
|
values[cycle] = x
|
||||||
|
|
||||||
|
cycle += 1
|
||||||
|
x += r
|
||||||
|
|
||||||
|
values[cycle] = x
|
||||||
|
|
||||||
|
answer_1 = sum(c * values[c] for c in range(20, max(values.keys()) + 1, 40))
|
||||||
|
yield answer_1
|
||||||
|
|
||||||
|
yield (
|
||||||
|
"\n"
|
||||||
|
+ "\n".join(
|
||||||
|
"".join(
|
||||||
|
"#"
|
||||||
|
if j >= (v := values[1 + i * 40 + j]) - 1 and j <= v + 1
|
||||||
|
else "."
|
||||||
|
for j in range(40)
|
||||||
|
)
|
||||||
|
for i in range(6)
|
||||||
|
)
|
||||||
|
+ "\n"
|
||||||
|
)
|
||||||
|
|||||||
@@ -1,7 +1,8 @@
|
|||||||
import copy
|
import copy
|
||||||
import sys
|
|
||||||
from functools import reduce
|
from functools import reduce
|
||||||
from typing import Callable, Final, Mapping, Sequence
|
from typing import Any, Callable, Final, Iterator, Mapping, Sequence
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
class Monkey:
|
class Monkey:
|
||||||
@@ -119,24 +120,28 @@ def monkey_business(inspects: dict[Monkey, int]) -> int:
|
|||||||
return sorted_levels[-2] * sorted_levels[-1]
|
return sorted_levels[-2] * sorted_levels[-1]
|
||||||
|
|
||||||
|
|
||||||
monkeys = [parse_monkey(block.splitlines()) for block in sys.stdin.read().split("\n\n")]
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
monkeys = [parse_monkey(block.splitlines()) for block in input.split("\n\n")]
|
||||||
|
|
||||||
# case 1: we simply divide the worry by 3 after applying the monkey worry operation
|
# case 1: we simply divide the worry by 3 after applying the monkey worry operation
|
||||||
answer_1 = monkey_business(
|
yield monkey_business(
|
||||||
run(copy.deepcopy(monkeys), 20, me_worry_fn=lambda w: w // 3)
|
run(copy.deepcopy(monkeys), 20, me_worry_fn=lambda w: w // 3)
|
||||||
)
|
)
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# case 2: to keep reasonable level values, we can use a modulo operation, we need to
|
# case 2: to keep reasonable level values, we can use a modulo operation, we need to
|
||||||
# use the product of all "divisible by" test so that the test remains valid
|
# use the product of all "divisible by" test so that the test remains valid
|
||||||
#
|
#
|
||||||
# (a + b) % c == ((a % c) + (b % c)) % c --- this would work for a single test value
|
# (a + b) % c == ((a % c) + (b % c)) % c --- this would work for a single test value
|
||||||
#
|
#
|
||||||
# (a + b) % c == ((a % d) + (b % d)) % c --- if d is a multiple of c, which is why here
|
# (a + b) % c == ((a % d) + (b % d)) % c --- if d is a multiple of c, which is why here
|
||||||
# we use the product of all test value
|
# we use the product of all test value
|
||||||
#
|
#
|
||||||
total_test_value = reduce(lambda w, m: w * m.test_value, monkeys, 1)
|
total_test_value = reduce(lambda w, m: w * m.test_value, monkeys, 1)
|
||||||
answer_2 = monkey_business(
|
yield monkey_business(
|
||||||
run(copy.deepcopy(monkeys), 10_000, me_worry_fn=lambda w: w % total_test_value)
|
run(
|
||||||
)
|
copy.deepcopy(monkeys),
|
||||||
print(f"answer 2 is {answer_2}")
|
10_000,
|
||||||
|
me_worry_fn=lambda w: w % total_test_value,
|
||||||
|
)
|
||||||
|
)
|
||||||
|
|||||||
@@ -1,6 +1,7 @@
|
|||||||
import heapq
|
import heapq
|
||||||
import sys
|
from typing import Any, Callable, Iterator, TypeVar
|
||||||
from typing import Callable, Iterator, TypeVar
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
Node = TypeVar("Node")
|
Node = TypeVar("Node")
|
||||||
|
|
||||||
@@ -68,30 +69,6 @@ def make_path(parents: dict[Node, Node], start: Node, end: Node) -> list[Node] |
|
|||||||
return list(reversed(path))
|
return list(reversed(path))
|
||||||
|
|
||||||
|
|
||||||
def print_path(path: list[tuple[int, int]], n_rows: int, n_cols: int) -> None:
|
|
||||||
end = path[-1]
|
|
||||||
|
|
||||||
graph = [["." for _c in range(n_cols)] for _r in range(n_rows)]
|
|
||||||
graph[end[0]][end[1]] = "E"
|
|
||||||
|
|
||||||
for i in range(0, len(path) - 1):
|
|
||||||
cr, cc = path[i]
|
|
||||||
nr, nc = path[i + 1]
|
|
||||||
|
|
||||||
if cr == nr and nc == cc - 1:
|
|
||||||
graph[cr][cc] = "<"
|
|
||||||
elif cr == nr and nc == cc + 1:
|
|
||||||
graph[cr][cc] = ">"
|
|
||||||
elif cr == nr - 1 and nc == cc:
|
|
||||||
graph[cr][cc] = "v"
|
|
||||||
elif cr == nr + 1 and nc == cc:
|
|
||||||
graph[cr][cc] = "^"
|
|
||||||
else:
|
|
||||||
assert False, "{} -> {} infeasible".format(path[i], path[i + 1])
|
|
||||||
|
|
||||||
print("\n".join("".join(row) for row in graph))
|
|
||||||
|
|
||||||
|
|
||||||
def neighbors(
|
def neighbors(
|
||||||
grid: list[list[int]], node: tuple[int, int], up: bool
|
grid: list[list[int]], node: tuple[int, int], up: bool
|
||||||
) -> Iterator[tuple[int, int]]:
|
) -> Iterator[tuple[int, int]]:
|
||||||
@@ -118,46 +95,82 @@ def neighbors(
|
|||||||
|
|
||||||
# === main code ===
|
# === main code ===
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
|
||||||
|
|
||||||
grid = [[ord(cell) - ord("a") for cell in line] for line in lines]
|
class Solver(BaseSolver):
|
||||||
|
def print_path(
|
||||||
|
self, name: str, path: list[tuple[int, int]], n_rows: int, n_cols: int
|
||||||
|
) -> None:
|
||||||
|
if not self.files:
|
||||||
|
return
|
||||||
|
|
||||||
start: tuple[int, int] | None = None
|
end = path[-1]
|
||||||
end: tuple[int, int] | None = None
|
|
||||||
|
|
||||||
# for part 2
|
graph = [["." for _c in range(n_cols)] for _r in range(n_rows)]
|
||||||
start_s: list[tuple[int, int]] = []
|
graph[end[0]][end[1]] = "E"
|
||||||
|
|
||||||
for i_row, row in enumerate(grid):
|
for i in range(0, len(path) - 1):
|
||||||
for i_col, col in enumerate(row):
|
cr, cc = path[i]
|
||||||
if chr(col + ord("a")) == "S":
|
nr, nc = path[i + 1]
|
||||||
start = (i_row, i_col)
|
|
||||||
start_s.append(start)
|
|
||||||
elif chr(col + ord("a")) == "E":
|
|
||||||
end = (i_row, i_col)
|
|
||||||
elif col == 0:
|
|
||||||
start_s.append((i_row, i_col))
|
|
||||||
|
|
||||||
assert start is not None
|
if cr == nr and nc == cc - 1:
|
||||||
assert end is not None
|
graph[cr][cc] = "<"
|
||||||
|
elif cr == nr and nc == cc + 1:
|
||||||
|
graph[cr][cc] = ">"
|
||||||
|
elif cr == nr - 1 and nc == cc:
|
||||||
|
graph[cr][cc] = "v"
|
||||||
|
elif cr == nr + 1 and nc == cc:
|
||||||
|
graph[cr][cc] = "^"
|
||||||
|
else:
|
||||||
|
assert False, "{} -> {} infeasible".format(path[i], path[i + 1])
|
||||||
|
|
||||||
# fix values
|
self.files.create(
|
||||||
grid[start[0]][start[1]] = 0
|
f"graph_{name}.txt",
|
||||||
grid[end[0]][end[1]] = ord("z") - ord("a")
|
"\n".join("".join(row) for row in graph).encode(),
|
||||||
|
text=True,
|
||||||
|
)
|
||||||
|
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
lengths_1, parents_1 = dijkstra(
|
grid = [[ord(cell) - ord("a") for cell in line] for line in lines]
|
||||||
start=start, neighbors=lambda n: neighbors(grid, n, True), cost=lambda lhs, rhs: 1
|
|
||||||
)
|
|
||||||
path_1 = make_path(parents_1, start, end)
|
|
||||||
assert path_1 is not None
|
|
||||||
|
|
||||||
print_path(path_1, n_rows=len(grid), n_cols=len(grid[0]))
|
start: tuple[int, int] | None = None
|
||||||
|
end: tuple[int, int] | None = None
|
||||||
|
|
||||||
print(f"answer 1 is {lengths_1[end] - 1}")
|
# for part 2
|
||||||
|
start_s: list[tuple[int, int]] = []
|
||||||
|
|
||||||
lengths_2, parents_2 = dijkstra(
|
for i_row, row in enumerate(grid):
|
||||||
start=end, neighbors=lambda n: neighbors(grid, n, False), cost=lambda lhs, rhs: 1
|
for i_col, col in enumerate(row):
|
||||||
)
|
if chr(col + ord("a")) == "S":
|
||||||
answer_2 = min(lengths_2.get(start, float("inf")) for start in start_s)
|
start = (i_row, i_col)
|
||||||
print(f"answer 2 is {answer_2}")
|
start_s.append(start)
|
||||||
|
elif chr(col + ord("a")) == "E":
|
||||||
|
end = (i_row, i_col)
|
||||||
|
elif col == 0:
|
||||||
|
start_s.append((i_row, i_col))
|
||||||
|
|
||||||
|
assert start is not None
|
||||||
|
assert end is not None
|
||||||
|
|
||||||
|
# fix values
|
||||||
|
grid[start[0]][start[1]] = 0
|
||||||
|
grid[end[0]][end[1]] = ord("z") - ord("a")
|
||||||
|
|
||||||
|
lengths_1, parents_1 = dijkstra(
|
||||||
|
start=start,
|
||||||
|
neighbors=lambda n: neighbors(grid, n, True),
|
||||||
|
cost=lambda lhs, rhs: 1,
|
||||||
|
)
|
||||||
|
path_1 = make_path(parents_1, start, end)
|
||||||
|
assert path_1 is not None
|
||||||
|
|
||||||
|
self.print_path("answer1", path_1, n_rows=len(grid), n_cols=len(grid[0]))
|
||||||
|
yield lengths_1[end] - 1
|
||||||
|
|
||||||
|
lengths_2, _ = dijkstra(
|
||||||
|
start=end,
|
||||||
|
neighbors=lambda n: neighbors(grid, n, False),
|
||||||
|
cost=lambda lhs, rhs: 1,
|
||||||
|
)
|
||||||
|
yield min(lengths_2.get(start, float("inf")) for start in start_s)
|
||||||
|
|||||||
@@ -1,11 +1,8 @@
|
|||||||
import json
|
import json
|
||||||
import sys
|
|
||||||
from functools import cmp_to_key
|
from functools import cmp_to_key
|
||||||
from typing import TypeAlias, cast
|
from typing import Any, Iterator, TypeAlias, cast
|
||||||
|
|
||||||
blocks = sys.stdin.read().strip().split("\n\n")
|
from ..base import BaseSolver
|
||||||
|
|
||||||
pairs = [tuple(json.loads(p) for p in block.split("\n")) for block in blocks]
|
|
||||||
|
|
||||||
Packet: TypeAlias = list[int | list["Packet"]]
|
Packet: TypeAlias = list[int | list["Packet"]]
|
||||||
|
|
||||||
@@ -28,14 +25,18 @@ def compare(lhs: Packet, rhs: Packet) -> int:
|
|||||||
return len(rhs) - len(lhs)
|
return len(rhs) - len(lhs)
|
||||||
|
|
||||||
|
|
||||||
answer_1 = sum(i + 1 for i, (lhs, rhs) in enumerate(pairs) if compare(lhs, rhs) > 0)
|
class Solver(BaseSolver):
|
||||||
print(f"answer_1 is {answer_1}")
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
blocks = input.split("\n\n")
|
||||||
|
pairs = [tuple(json.loads(p) for p in block.split("\n")) for block in blocks]
|
||||||
|
|
||||||
dividers = [[[2]], [[6]]]
|
yield sum(i + 1 for i, (lhs, rhs) in enumerate(pairs) if compare(lhs, rhs) > 0)
|
||||||
|
|
||||||
packets = [packet for packets in pairs for packet in packets]
|
dividers = [[[2]], [[6]]]
|
||||||
packets.extend(dividers)
|
|
||||||
packets = list(reversed(sorted(packets, key=cmp_to_key(compare))))
|
|
||||||
|
|
||||||
d_index = [packets.index(d) + 1 for d in dividers]
|
packets = [packet for packets in pairs for packet in packets]
|
||||||
print(f"answer 2 is {d_index[0] * d_index[1]}")
|
packets.extend(dividers)
|
||||||
|
packets = list(reversed(sorted(packets, key=cmp_to_key(compare))))
|
||||||
|
|
||||||
|
d_index = [packets.index(d) + 1 for d in dividers]
|
||||||
|
yield d_index[0] * d_index[1]
|
||||||
|
|||||||
@@ -1,6 +1,7 @@
|
|||||||
import sys
|
|
||||||
from enum import Enum, auto
|
from enum import Enum, auto
|
||||||
from typing import Callable, cast
|
from typing import Any, Callable, Iterator, cast
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
class Cell(Enum):
|
class Cell(Enum):
|
||||||
@@ -12,26 +13,6 @@ class Cell(Enum):
|
|||||||
return {Cell.AIR: ".", Cell.ROCK: "#", Cell.SAND: "O"}[self]
|
return {Cell.AIR: ".", Cell.ROCK: "#", Cell.SAND: "O"}[self]
|
||||||
|
|
||||||
|
|
||||||
def print_blocks(blocks: dict[tuple[int, int], Cell]):
|
|
||||||
"""
|
|
||||||
Print the given set of blocks on a grid.
|
|
||||||
|
|
||||||
Args:
|
|
||||||
blocks: Set of blocks to print.
|
|
||||||
"""
|
|
||||||
x_min, y_min, x_max, y_max = (
|
|
||||||
min(x for x, _ in blocks),
|
|
||||||
0,
|
|
||||||
max(x for x, _ in blocks),
|
|
||||||
max(y for _, y in blocks),
|
|
||||||
)
|
|
||||||
|
|
||||||
for y in range(y_min, y_max + 1):
|
|
||||||
print(
|
|
||||||
"".join(str(blocks.get((x, y), Cell.AIR)) for x in range(x_min, x_max + 1))
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
def flow(
|
def flow(
|
||||||
blocks: dict[tuple[int, int], Cell],
|
blocks: dict[tuple[int, int], Cell],
|
||||||
stop_fn: Callable[[int, int], bool],
|
stop_fn: Callable[[int, int], bool],
|
||||||
@@ -84,57 +65,82 @@ def flow(
|
|||||||
|
|
||||||
# === inputs ===
|
# === inputs ===
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
|
||||||
|
|
||||||
paths: list[list[tuple[int, int]]] = []
|
class Solver(BaseSolver):
|
||||||
for line in lines:
|
def print_blocks(self, name: str, blocks: dict[tuple[int, int], Cell]):
|
||||||
parts = line.split(" -> ")
|
"""
|
||||||
paths.append(
|
Print the given set of blocks on a grid.
|
||||||
[
|
|
||||||
cast(tuple[int, int], tuple(int(c.strip()) for c in part.split(",")))
|
|
||||||
for part in parts
|
|
||||||
]
|
|
||||||
)
|
|
||||||
|
|
||||||
|
Args:
|
||||||
|
blocks: Set of blocks to print.
|
||||||
|
"""
|
||||||
|
if not self.files:
|
||||||
|
return
|
||||||
|
|
||||||
blocks: dict[tuple[int, int], Cell] = {}
|
x_min, y_min, x_max, y_max = (
|
||||||
for path in paths:
|
min(x for x, _ in blocks),
|
||||||
for start, end in zip(path[:-1], path[1:]):
|
0,
|
||||||
x_start = min(start[0], end[0])
|
max(x for x, _ in blocks),
|
||||||
x_end = max(start[0], end[0]) + 1
|
max(y for _, y in blocks),
|
||||||
y_start = min(start[1], end[1])
|
)
|
||||||
y_end = max(start[1], end[1]) + 1
|
|
||||||
|
|
||||||
for x in range(x_start, x_end):
|
self.files.create(
|
||||||
for y in range(y_start, y_end):
|
f"blocks_{name}.txt",
|
||||||
blocks[x, y] = Cell.ROCK
|
"\n".join(
|
||||||
|
"".join(
|
||||||
|
str(blocks.get((x, y), Cell.AIR)) for x in range(x_min, x_max + 1)
|
||||||
|
)
|
||||||
|
for y in range(y_min, y_max + 1)
|
||||||
|
).encode(),
|
||||||
|
True,
|
||||||
|
)
|
||||||
|
|
||||||
print_blocks(blocks)
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
print()
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
x_min, y_min, x_max, y_max = (
|
paths: list[list[tuple[int, int]]] = []
|
||||||
min(x for x, _ in blocks),
|
for line in lines:
|
||||||
0,
|
parts = line.split(" -> ")
|
||||||
max(x for x, _ in blocks),
|
paths.append(
|
||||||
max(y for _, y in blocks),
|
[
|
||||||
)
|
cast(
|
||||||
|
tuple[int, int], tuple(int(c.strip()) for c in part.split(","))
|
||||||
|
)
|
||||||
|
for part in parts
|
||||||
|
]
|
||||||
|
)
|
||||||
|
|
||||||
# === part 1 ===
|
blocks: dict[tuple[int, int], Cell] = {}
|
||||||
|
for path in paths:
|
||||||
|
for start, end in zip(path[:-1], path[1:]):
|
||||||
|
x_start = min(start[0], end[0])
|
||||||
|
x_end = max(start[0], end[0]) + 1
|
||||||
|
y_start = min(start[1], end[1])
|
||||||
|
y_end = max(start[1], end[1]) + 1
|
||||||
|
|
||||||
blocks_1 = flow(
|
for x in range(x_start, x_end):
|
||||||
blocks.copy(), stop_fn=lambda x, y: y > y_max, fill_fn=lambda x, y: Cell.AIR
|
for y in range(y_start, y_end):
|
||||||
)
|
blocks[x, y] = Cell.ROCK
|
||||||
print_blocks(blocks_1)
|
|
||||||
print(f"answer 1 is {sum(v == Cell.SAND for v in blocks_1.values())}")
|
|
||||||
print()
|
|
||||||
|
|
||||||
# === part 2 ===
|
self.print_blocks("start", blocks)
|
||||||
|
|
||||||
blocks_2 = flow(
|
y_max = max(y for _, y in blocks)
|
||||||
blocks.copy(),
|
|
||||||
stop_fn=lambda x, y: x == 500 and y == 0,
|
# === part 1 ===
|
||||||
fill_fn=lambda x, y: Cell.AIR if y < y_max + 2 else Cell.ROCK,
|
|
||||||
)
|
blocks_1 = flow(
|
||||||
blocks_2[500, 0] = Cell.SAND
|
blocks.copy(), stop_fn=lambda x, y: y > y_max, fill_fn=lambda x, y: Cell.AIR
|
||||||
print_blocks(blocks_2)
|
)
|
||||||
print(f"answer 2 is {sum(v == Cell.SAND for v in blocks_2.values())}")
|
self.print_blocks("part1", blocks_1)
|
||||||
|
yield sum(v == Cell.SAND for v in blocks_1.values())
|
||||||
|
|
||||||
|
# === part 2 ===
|
||||||
|
|
||||||
|
blocks_2 = flow(
|
||||||
|
blocks.copy(),
|
||||||
|
stop_fn=lambda x, y: x == 500 and y == 0,
|
||||||
|
fill_fn=lambda x, y: Cell.AIR if y < y_max + 2 else Cell.ROCK,
|
||||||
|
)
|
||||||
|
blocks_2[500, 0] = Cell.SAND
|
||||||
|
self.print_blocks("part2", blocks_2)
|
||||||
|
yield sum(v == Cell.SAND for v in blocks_2.values())
|
||||||
|
|||||||
@@ -1,4 +1,4 @@
|
|||||||
import sys
|
import itertools as it
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
@@ -21,9 +21,7 @@ class Solver(BaseSolver):
|
|||||||
no_beacons_row_l.append(sx + np.arange(0, d - abs(sy - row) + 1)) # type: ignore
|
no_beacons_row_l.append(sx + np.arange(0, d - abs(sy - row) + 1)) # type: ignore
|
||||||
|
|
||||||
beacons_at_row = set(bx for (bx, by) in sensor_to_beacon.values() if by == row)
|
beacons_at_row = set(bx for (bx, by) in sensor_to_beacon.values() if by == row)
|
||||||
no_beacons_row = set(np.concatenate(no_beacons_row_l)).difference(
|
no_beacons_row = set(it.chain(*no_beacons_row_l)).difference(beacons_at_row) # type: ignore
|
||||||
beacons_at_row
|
|
||||||
) # type: ignore
|
|
||||||
|
|
||||||
return len(no_beacons_row)
|
return len(no_beacons_row)
|
||||||
|
|
||||||
@@ -62,8 +60,9 @@ class Solver(BaseSolver):
|
|||||||
for (sx, sy), (bx, by) in sensor_to_beacon.items():
|
for (sx, sy), (bx, by) in sensor_to_beacon.items():
|
||||||
d = abs(sx - bx) + abs(sy - by)
|
d = abs(sx - bx) + abs(sy - by)
|
||||||
m.add_constraint(
|
m.add_constraint(
|
||||||
m.abs(x - sx) + m.abs(y - sy) >= d + 1, ctname=f"ct_{sx}_{sy}"
|
m.abs(x - sx) + m.abs(y - sy) >= d + 1, # type: ignore
|
||||||
) # type: ignore
|
ctname=f"ct_{sx}_{sy}",
|
||||||
|
)
|
||||||
|
|
||||||
m.set_objective("min", x + y)
|
m.set_objective("min", x + y)
|
||||||
|
|
||||||
@@ -92,5 +91,5 @@ class Solver(BaseSolver):
|
|||||||
|
|
||||||
# x, y, a2 = part2_cplex(sensor_to_beacon, xy_max)
|
# x, y, a2 = part2_cplex(sensor_to_beacon, xy_max)
|
||||||
x, y, a2 = self.part2_intervals(sensor_to_beacon, xy_max)
|
x, y, a2 = self.part2_intervals(sensor_to_beacon, xy_max)
|
||||||
self.logger.info("answer 2 is {at} (x={x}, y={y})")
|
self.logger.info(f"answer 2 is {a2} (x={x}, y={y})")
|
||||||
yield a2
|
yield a2
|
||||||
|
|||||||
@@ -3,11 +3,10 @@ from __future__ import annotations
|
|||||||
import heapq
|
import heapq
|
||||||
import itertools
|
import itertools
|
||||||
import re
|
import re
|
||||||
import sys
|
|
||||||
from collections import defaultdict
|
from collections import defaultdict
|
||||||
from typing import FrozenSet, NamedTuple
|
from typing import Any, FrozenSet, Iterator, NamedTuple
|
||||||
|
|
||||||
from tqdm import tqdm
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
class Pipe(NamedTuple):
|
class Pipe(NamedTuple):
|
||||||
@@ -36,8 +35,8 @@ def breadth_first_search(pipes: dict[str, Pipe], pipe: Pipe) -> dict[Pipe, int]:
|
|||||||
Runs a BFS from the given pipe and return the shortest distance (in term of hops)
|
Runs a BFS from the given pipe and return the shortest distance (in term of hops)
|
||||||
to all other pipes.
|
to all other pipes.
|
||||||
"""
|
"""
|
||||||
queue = [(0, pipe_1)]
|
queue = [(0, pipe)]
|
||||||
visited = set()
|
visited: set[Pipe] = set()
|
||||||
distances: dict[Pipe, int] = {}
|
distances: dict[Pipe, int] = {}
|
||||||
|
|
||||||
while len(distances) < len(pipes):
|
while len(distances) < len(pipes):
|
||||||
@@ -61,98 +60,100 @@ def update_with_better(
|
|||||||
node_at_times[flowing] = max(node_at_times[flowing], flow)
|
node_at_times[flowing] = max(node_at_times[flowing], flow)
|
||||||
|
|
||||||
|
|
||||||
def part_1(
|
|
||||||
start_pipe: Pipe,
|
|
||||||
max_time: int,
|
|
||||||
distances: dict[tuple[Pipe, Pipe], int],
|
|
||||||
relevant_pipes: FrozenSet[Pipe],
|
|
||||||
):
|
|
||||||
node_at_times: dict[int, dict[Pipe, dict[FrozenSet[Pipe], int]]] = defaultdict(
|
|
||||||
lambda: defaultdict(lambda: defaultdict(lambda: 0))
|
|
||||||
)
|
|
||||||
node_at_times[0] = {start_pipe: {frozenset(): 0}}
|
|
||||||
|
|
||||||
for time in range(max_time):
|
|
||||||
for c_pipe, nodes in node_at_times[time].items():
|
|
||||||
for flowing, flow in nodes.items():
|
|
||||||
for target in relevant_pipes:
|
|
||||||
distance = distances[c_pipe, target] + 1
|
|
||||||
if time + distance >= max_time or target in flowing:
|
|
||||||
continue
|
|
||||||
|
|
||||||
update_with_better(
|
|
||||||
node_at_times[time + distance][target],
|
|
||||||
flow + sum(pipe.flow for pipe in flowing) * distance,
|
|
||||||
flowing | {target},
|
|
||||||
)
|
|
||||||
|
|
||||||
update_with_better(
|
|
||||||
node_at_times[max_time][c_pipe],
|
|
||||||
flow + sum(pipe.flow for pipe in flowing) * (max_time - time),
|
|
||||||
flowing,
|
|
||||||
)
|
|
||||||
|
|
||||||
return max(
|
|
||||||
flow
|
|
||||||
for nodes_of_pipe in node_at_times[max_time].values()
|
|
||||||
for flow in nodes_of_pipe.values()
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
def part_2(
|
|
||||||
start_pipe: Pipe,
|
|
||||||
max_time: int,
|
|
||||||
distances: dict[tuple[Pipe, Pipe], int],
|
|
||||||
relevant_pipes: FrozenSet[Pipe],
|
|
||||||
):
|
|
||||||
def compute(pipes_for_me: FrozenSet[Pipe]) -> int:
|
|
||||||
return part_1(start_pipe, max_time, distances, pipes_for_me) + part_1(
|
|
||||||
start_pipe, max_time, distances, relevant_pipes - pipes_for_me
|
|
||||||
)
|
|
||||||
|
|
||||||
combs = [
|
|
||||||
frozenset(relevant_pipes_1)
|
|
||||||
for r in range(2, len(relevant_pipes) // 2 + 1)
|
|
||||||
for relevant_pipes_1 in itertools.combinations(relevant_pipes, r)
|
|
||||||
]
|
|
||||||
|
|
||||||
return max(compute(comb) for comb in tqdm(combs))
|
|
||||||
|
|
||||||
|
|
||||||
# === MAIN ===
|
# === MAIN ===
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
class Solver(BaseSolver):
|
||||||
|
def part_1(
|
||||||
|
self,
|
||||||
|
start_pipe: Pipe,
|
||||||
|
max_time: int,
|
||||||
|
distances: dict[tuple[Pipe, Pipe], int],
|
||||||
|
relevant_pipes: FrozenSet[Pipe],
|
||||||
|
):
|
||||||
|
node_at_times: dict[int, dict[Pipe, dict[FrozenSet[Pipe], int]]] = defaultdict(
|
||||||
|
lambda: defaultdict(lambda: defaultdict(lambda: 0))
|
||||||
|
)
|
||||||
|
node_at_times[0] = {start_pipe: {frozenset(): 0}}
|
||||||
|
|
||||||
|
for time in range(max_time):
|
||||||
|
for c_pipe, nodes in node_at_times[time].items():
|
||||||
|
for flowing, flow in nodes.items():
|
||||||
|
for target in relevant_pipes:
|
||||||
|
distance = distances[c_pipe, target] + 1
|
||||||
|
if time + distance >= max_time or target in flowing:
|
||||||
|
continue
|
||||||
|
|
||||||
pipes: dict[str, Pipe] = {}
|
update_with_better(
|
||||||
for line in lines:
|
node_at_times[time + distance][target],
|
||||||
r = re.match(
|
flow + sum(pipe.flow for pipe in flowing) * distance,
|
||||||
R"Valve ([A-Z]+) has flow rate=([0-9]+); tunnels? leads? to valves? (.+)",
|
flowing | {target},
|
||||||
line,
|
)
|
||||||
)
|
|
||||||
assert r
|
|
||||||
|
|
||||||
g = r.groups()
|
update_with_better(
|
||||||
|
node_at_times[max_time][c_pipe],
|
||||||
|
flow + sum(pipe.flow for pipe in flowing) * (max_time - time),
|
||||||
|
flowing,
|
||||||
|
)
|
||||||
|
|
||||||
pipes[g[0]] = Pipe(g[0], int(g[1]), g[2].split(", "))
|
return max(
|
||||||
|
flow
|
||||||
|
for nodes_of_pipe in node_at_times[max_time].values()
|
||||||
|
for flow in nodes_of_pipe.values()
|
||||||
|
)
|
||||||
|
|
||||||
# compute distances from one valve to any other
|
def part_2(
|
||||||
distances: dict[tuple[Pipe, Pipe], int] = {}
|
self,
|
||||||
for pipe_1 in pipes.values():
|
start_pipe: Pipe,
|
||||||
distances.update(
|
max_time: int,
|
||||||
{
|
distances: dict[tuple[Pipe, Pipe], int],
|
||||||
(pipe_1, pipe_2): distance
|
relevant_pipes: FrozenSet[Pipe],
|
||||||
for pipe_2, distance in breadth_first_search(pipes, pipe_1).items()
|
):
|
||||||
}
|
def compute(pipes_for_me: FrozenSet[Pipe]) -> int:
|
||||||
)
|
return self.part_1(
|
||||||
|
start_pipe, max_time, distances, pipes_for_me
|
||||||
|
) + self.part_1(
|
||||||
|
start_pipe, max_time, distances, relevant_pipes - pipes_for_me
|
||||||
|
)
|
||||||
|
|
||||||
# valves with flow
|
combs = [
|
||||||
relevant_pipes = frozenset(pipe for pipe in pipes.values() if pipe.flow > 0)
|
frozenset(relevant_pipes_1)
|
||||||
|
for r in range(2, len(relevant_pipes) // 2 + 1)
|
||||||
|
for relevant_pipes_1 in itertools.combinations(relevant_pipes, r)
|
||||||
|
]
|
||||||
|
|
||||||
|
return max(compute(comb) for comb in self.progress.wrap(combs))
|
||||||
|
|
||||||
# 1651, 1653
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
print(part_1(pipes["AA"], 30, distances, relevant_pipes))
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
# 1707, 2223
|
pipes: dict[str, Pipe] = {}
|
||||||
print(part_2(pipes["AA"], 26, distances, relevant_pipes))
|
for line in lines:
|
||||||
|
r = re.match(
|
||||||
|
R"Valve ([A-Z]+) has flow rate=([0-9]+); tunnels? leads? to valves? (.+)",
|
||||||
|
line,
|
||||||
|
)
|
||||||
|
assert r
|
||||||
|
|
||||||
|
g = r.groups()
|
||||||
|
|
||||||
|
pipes[g[0]] = Pipe(g[0], int(g[1]), g[2].split(", "))
|
||||||
|
|
||||||
|
# compute distances from one valve to any other
|
||||||
|
distances: dict[tuple[Pipe, Pipe], int] = {}
|
||||||
|
for pipe_1 in pipes.values():
|
||||||
|
distances.update(
|
||||||
|
{
|
||||||
|
(pipe_1, pipe_2): distance
|
||||||
|
for pipe_2, distance in breadth_first_search(pipes, pipe_1).items()
|
||||||
|
}
|
||||||
|
)
|
||||||
|
|
||||||
|
# valves with flow
|
||||||
|
relevant_pipes = frozenset(pipe for pipe in pipes.values() if pipe.flow > 0)
|
||||||
|
|
||||||
|
# 1651, 1653
|
||||||
|
yield self.part_1(pipes["AA"], 30, distances, relevant_pipes)
|
||||||
|
|
||||||
|
# 1707, 2223
|
||||||
|
yield self.part_2(pipes["AA"], 26, distances, relevant_pipes)
|
||||||
|
|||||||
@@ -1,23 +1,16 @@
|
|||||||
import sys
|
from typing import Any, Iterator, Sequence, TypeAlias, TypeVar
|
||||||
from typing import Sequence, TypeVar
|
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
from numpy.typing import NDArray
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
T = TypeVar("T")
|
T = TypeVar("T")
|
||||||
|
|
||||||
|
Tower: TypeAlias = NDArray[np.bool]
|
||||||
def print_tower(tower: np.ndarray, out: str = "#"):
|
|
||||||
print("-" * (tower.shape[1] + 2))
|
|
||||||
non_empty = False
|
|
||||||
for row in reversed(range(1, tower.shape[0])):
|
|
||||||
if not non_empty and not tower[row, :].any():
|
|
||||||
continue
|
|
||||||
non_empty = True
|
|
||||||
print("|" + "".join(out if c else "." for c in tower[row, :]) + "|")
|
|
||||||
print("+" + "-" * tower.shape[1] + "+")
|
|
||||||
|
|
||||||
|
|
||||||
def tower_height(tower: np.ndarray) -> int:
|
def tower_height(tower: Tower) -> int:
|
||||||
return int(tower.shape[0] - tower[::-1, :].argmax(axis=0).min() - 1)
|
return int(tower.shape[0] - tower[::-1, :].argmax(axis=0).min() - 1)
|
||||||
|
|
||||||
|
|
||||||
@@ -45,8 +38,8 @@ def build_tower(
|
|||||||
n_rocks: int,
|
n_rocks: int,
|
||||||
jets: str,
|
jets: str,
|
||||||
early_stop: bool = False,
|
early_stop: bool = False,
|
||||||
init: np.ndarray = np.ones(WIDTH, dtype=bool),
|
init: Tower = np.ones(WIDTH, dtype=bool),
|
||||||
) -> tuple[np.ndarray, int, int, dict[int, int]]:
|
) -> tuple[Tower, int, int, dict[int, int]]:
|
||||||
tower = EMPTY_BLOCKS.copy()
|
tower = EMPTY_BLOCKS.copy()
|
||||||
tower[0, :] = init
|
tower[0, :] = init
|
||||||
|
|
||||||
@@ -95,26 +88,24 @@ def build_tower(
|
|||||||
return tower, rock_count, done_at.get((i_rock, i_jet), -1), heights
|
return tower, rock_count, done_at.get((i_rock, i_jet), -1), heights
|
||||||
|
|
||||||
|
|
||||||
line = sys.stdin.read().strip()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
tower, *_ = build_tower(2022, input)
|
||||||
|
yield tower_height(tower)
|
||||||
|
|
||||||
tower, *_ = build_tower(2022, line)
|
TOTAL_ROCKS = 1_000_000_000_000
|
||||||
answer_1 = tower_height(tower)
|
_tower_1, n_rocks_1, prev_1, heights_1 = build_tower(TOTAL_ROCKS, input, True)
|
||||||
print(f"answer 1 is {answer_1}")
|
assert prev_1 > 0
|
||||||
|
|
||||||
TOTAL_ROCKS = 1_000_000_000_000
|
# 2767 1513
|
||||||
tower_1, n_rocks_1, prev_1, heights_1 = build_tower(TOTAL_ROCKS, line, True)
|
remaining_rocks = TOTAL_ROCKS - n_rocks_1
|
||||||
assert prev_1 > 0
|
n_repeat_rocks = n_rocks_1 - prev_1
|
||||||
|
n_repeat_towers = remaining_rocks // n_repeat_rocks
|
||||||
|
|
||||||
# 2767 1513
|
base_height = heights_1[prev_1]
|
||||||
remaining_rocks = TOTAL_ROCKS - n_rocks_1
|
repeat_height = heights_1[prev_1 + n_repeat_rocks - 1] - heights_1[prev_1]
|
||||||
n_repeat_rocks = n_rocks_1 - prev_1
|
remaining_height = (
|
||||||
n_repeat_towers = remaining_rocks // n_repeat_rocks
|
heights_1[prev_1 + remaining_rocks % n_repeat_rocks] - heights_1[prev_1]
|
||||||
|
)
|
||||||
|
|
||||||
base_height = heights_1[prev_1]
|
yield base_height + (n_repeat_towers + 1) * repeat_height + remaining_height
|
||||||
repeat_height = heights_1[prev_1 + n_repeat_rocks - 1] - heights_1[prev_1]
|
|
||||||
remaining_height = (
|
|
||||||
heights_1[prev_1 + remaining_rocks % n_repeat_rocks] - heights_1[prev_1]
|
|
||||||
)
|
|
||||||
|
|
||||||
answer_2 = base_height + (n_repeat_towers + 1) * repeat_height + remaining_height
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,50 +1,58 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
|
||||||
xyz = np.asarray(
|
from ..base import BaseSolver
|
||||||
[
|
|
||||||
tuple(int(x) for x in row.split(",")) # type: ignore
|
|
||||||
for row in sys.stdin.read().splitlines()
|
|
||||||
]
|
|
||||||
)
|
|
||||||
|
|
||||||
xyz = xyz - xyz.min(axis=0) + 1
|
|
||||||
|
|
||||||
cubes = np.zeros(xyz.max(axis=0) + 3, dtype=bool)
|
class Solver(BaseSolver):
|
||||||
cubes[xyz[:, 0], xyz[:, 1], xyz[:, 2]] = True
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
xyz = np.asarray(
|
||||||
|
[
|
||||||
|
tuple(int(x) for x in row.split(",")) # type: ignore
|
||||||
|
for row in input.splitlines()
|
||||||
|
]
|
||||||
|
)
|
||||||
|
|
||||||
n_dims = len(cubes.shape)
|
xyz = xyz - xyz.min(axis=0) + 1
|
||||||
|
|
||||||
faces = [(-1, 0, 0), (1, 0, 0), (0, -1, 0), (0, 1, 0), (0, 0, -1), (0, 0, 1)]
|
cubes = np.zeros(xyz.max(axis=0) + 3, dtype=bool)
|
||||||
|
cubes[xyz[:, 0], xyz[:, 1], xyz[:, 2]] = True
|
||||||
|
|
||||||
answer_1 = sum(
|
faces = [(-1, 0, 0), (1, 0, 0), (0, -1, 0), (0, 1, 0), (0, 0, -1), (0, 0, 1)]
|
||||||
1 for x, y, z in xyz for dx, dy, dz in faces if not cubes[x + dx, y + dy, z + dz]
|
|
||||||
)
|
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
visited = np.zeros_like(cubes, dtype=bool)
|
yield sum(
|
||||||
queue = [(0, 0, 0)]
|
1
|
||||||
|
for x, y, z in xyz
|
||||||
|
for dx, dy, dz in faces
|
||||||
|
if not cubes[x + dx, y + dy, z + dz]
|
||||||
|
)
|
||||||
|
|
||||||
n_faces = 0
|
visited = np.zeros_like(cubes, dtype=bool)
|
||||||
while queue:
|
queue = [(0, 0, 0)]
|
||||||
x, y, z = queue.pop(0)
|
|
||||||
|
|
||||||
if visited[x, y, z]:
|
n_faces = 0
|
||||||
continue
|
while queue:
|
||||||
|
x, y, z = queue.pop(0)
|
||||||
|
|
||||||
visited[x, y, z] = True
|
if visited[x, y, z]:
|
||||||
|
continue
|
||||||
|
|
||||||
for dx, dy, dz in faces:
|
visited[x, y, z] = True
|
||||||
nx, ny, nz = x + dx, y + dy, z + dz
|
|
||||||
if not all(n >= 0 and n < cubes.shape[i] for i, n in enumerate((nx, ny, nz))):
|
|
||||||
continue
|
|
||||||
|
|
||||||
if visited[nx, ny, nz]:
|
for dx, dy, dz in faces:
|
||||||
continue
|
nx, ny, nz = x + dx, y + dy, z + dz
|
||||||
|
if not all(
|
||||||
|
n >= 0 and n < cubes.shape[i] for i, n in enumerate((nx, ny, nz))
|
||||||
|
):
|
||||||
|
continue
|
||||||
|
|
||||||
if cubes[nx, ny, nz]:
|
if visited[nx, ny, nz]:
|
||||||
n_faces += 1
|
continue
|
||||||
else:
|
|
||||||
queue.append((nx, ny, nz))
|
if cubes[nx, ny, nz]:
|
||||||
print(f"answer 2 is {n_faces}")
|
n_faces += 1
|
||||||
|
else:
|
||||||
|
queue.append((nx, ny, nz))
|
||||||
|
|
||||||
|
yield n_faces
|
||||||
|
|||||||
@@ -1,10 +1,11 @@
|
|||||||
import sys
|
from typing import Any, Iterator, Literal
|
||||||
from typing import Any, Literal
|
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
import parse # pyright: ignore[reportMissingTypeStubs]
|
import parse # pyright: ignore[reportMissingTypeStubs]
|
||||||
from numpy.typing import NDArray
|
from numpy.typing import NDArray
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
Reagent = Literal["ore", "clay", "obsidian", "geode"]
|
Reagent = Literal["ore", "clay", "obsidian", "geode"]
|
||||||
REAGENTS: tuple[Reagent, ...] = (
|
REAGENTS: tuple[Reagent, ...] = (
|
||||||
"ore",
|
"ore",
|
||||||
@@ -62,29 +63,6 @@ def dominates(lhs: State, rhs: State):
|
|||||||
)
|
)
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
|
||||||
|
|
||||||
blueprints: list[dict[Reagent, IntOfReagent]] = []
|
|
||||||
for line in lines:
|
|
||||||
r: list[int] = parse.parse( # type: ignore
|
|
||||||
"Blueprint {}: "
|
|
||||||
"Each ore robot costs {:d} ore. "
|
|
||||||
"Each clay robot costs {:d} ore. "
|
|
||||||
"Each obsidian robot costs {:d} ore and {:d} clay. "
|
|
||||||
"Each geode robot costs {:d} ore and {:d} obsidian.",
|
|
||||||
line,
|
|
||||||
)
|
|
||||||
|
|
||||||
blueprints.append(
|
|
||||||
{
|
|
||||||
"ore": {"ore": r[1]},
|
|
||||||
"clay": {"ore": r[2]},
|
|
||||||
"obsidian": {"ore": r[3], "clay": r[4]},
|
|
||||||
"geode": {"ore": r[5], "obsidian": r[6]},
|
|
||||||
}
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
def run(blueprint: dict[Reagent, dict[Reagent, int]], max_time: int) -> int:
|
def run(blueprint: dict[Reagent, dict[Reagent, int]], max_time: int) -> int:
|
||||||
# since we can only build one robot per time, we do not need more than X robots
|
# since we can only build one robot per time, we do not need more than X robots
|
||||||
# of type K where X is the maximum number of K required among all robots, e.g.,
|
# of type K where X is the maximum number of K required among all robots, e.g.,
|
||||||
@@ -173,11 +151,31 @@ def run(blueprint: dict[Reagent, dict[Reagent, int]], max_time: int) -> int:
|
|||||||
return max(state.reagents["geode"] for state in state_after_t[max_time])
|
return max(state.reagents["geode"] for state in state_after_t[max_time])
|
||||||
|
|
||||||
|
|
||||||
answer_1 = sum(
|
class Solver(BaseSolver):
|
||||||
(i_blueprint + 1) * run(blueprint, 24)
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
for i_blueprint, blueprint in enumerate(blueprints)
|
blueprints: list[dict[Reagent, IntOfReagent]] = []
|
||||||
)
|
for line in input.splitlines():
|
||||||
print(f"answer 1 is {answer_1}")
|
r: list[int] = parse.parse( # type: ignore
|
||||||
|
"Blueprint {}: "
|
||||||
|
"Each ore robot costs {:d} ore. "
|
||||||
|
"Each clay robot costs {:d} ore. "
|
||||||
|
"Each obsidian robot costs {:d} ore and {:d} clay. "
|
||||||
|
"Each geode robot costs {:d} ore and {:d} obsidian.",
|
||||||
|
line,
|
||||||
|
)
|
||||||
|
|
||||||
answer_2 = run(blueprints[0], 32) * run(blueprints[1], 32) * run(blueprints[2], 32)
|
blueprints.append(
|
||||||
print(f"answer 2 is {answer_2}")
|
{
|
||||||
|
"ore": {"ore": r[1]},
|
||||||
|
"clay": {"ore": r[2]},
|
||||||
|
"obsidian": {"ore": r[3], "clay": r[4]},
|
||||||
|
"geode": {"ore": r[5], "obsidian": r[6]},
|
||||||
|
}
|
||||||
|
)
|
||||||
|
|
||||||
|
yield sum(
|
||||||
|
(i_blueprint + 1) * run(blueprint, 24)
|
||||||
|
for i_blueprint, blueprint in enumerate(blueprints)
|
||||||
|
)
|
||||||
|
|
||||||
|
yield (run(blueprints[0], 32) * run(blueprints[1], 32) * run(blueprints[2], 32))
|
||||||
|
|||||||
@@ -1,4 +1,6 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def score_1(ux: int, vx: int) -> int:
|
def score_1(ux: int, vx: int) -> int:
|
||||||
@@ -33,21 +35,23 @@ def score_2(ux: int, vx: int) -> int:
|
|||||||
return (ux + vx - 1) % 3 + 1 + vx * 3
|
return (ux + vx - 1) % 3 + 1 + vx * 3
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.readlines()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = input.splitlines()
|
||||||
|
|
||||||
# the solution relies on replacing rock / paper / scissor by values 0 / 1 / 2 and using
|
# the solution relies on replacing rock / paper / scissor by values 0 / 1 / 2 and using
|
||||||
# modulo-3 arithmetic
|
# modulo-3 arithmetic
|
||||||
#
|
#
|
||||||
# in modulo-3 arithmetic, the winning move is 1 + the opponent move (e.g., winning move
|
# in modulo-3 arithmetic, the winning move is 1 + the opponent move (e.g., winning move
|
||||||
# if opponent plays 0 is 1, or 0 if opponent plays 2 (0 = (2 + 1 % 3)))
|
# if opponent plays 0 is 1, or 0 if opponent plays 2 (0 = (2 + 1 % 3)))
|
||||||
#
|
#
|
||||||
|
|
||||||
# we read the lines in a Nx2 in array with value 0/1/2 instead of A/B/C or X/Y/Z for
|
# we read the lines in a Nx2 in array with value 0/1/2 instead of A/B/C or X/Y/Z for
|
||||||
# easier manipulation
|
# easier manipulation
|
||||||
values = [(ord(row[0]) - ord("A"), ord(row[2]) - ord("X")) for row in lines]
|
values = [(ord(row[0]) - ord("A"), ord(row[2]) - ord("X")) for row in lines]
|
||||||
|
|
||||||
# part 1 - 13526
|
# part 1 - 13526
|
||||||
print(f"answer 1 is {sum(score_1(*v) for v in values)}")
|
yield sum(score_1(*v) for v in values)
|
||||||
|
|
||||||
# part 2 - 14204
|
# part 2 - 14204
|
||||||
print(f"answer 2 is {sum(score_2(*v) for v in values)}")
|
yield sum(score_2(*v) for v in values)
|
||||||
|
|||||||
@@ -1,6 +1,8 @@
|
|||||||
from __future__ import annotations
|
from __future__ import annotations
|
||||||
|
|
||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
class Number:
|
class Number:
|
||||||
@@ -65,10 +67,9 @@ def decrypt(numbers: list[Number], key: int, rounds: int) -> int:
|
|||||||
)
|
)
|
||||||
|
|
||||||
|
|
||||||
numbers = [Number(int(x)) for i, x in enumerate(sys.stdin.readlines())]
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
numbers = [Number(int(x)) for x in input.splitlines()]
|
||||||
|
|
||||||
answer_1 = decrypt(numbers, 1, 1)
|
yield decrypt(numbers, 1, 1)
|
||||||
print(f"answer 1 is {answer_1}")
|
yield decrypt(numbers, 811589153, 10)
|
||||||
|
|
||||||
answer_2 = decrypt(numbers, 811589153, 10)
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,6 +1,7 @@
|
|||||||
import operator
|
import operator
|
||||||
import sys
|
from typing import Any, Callable, Iterator
|
||||||
from typing import Callable
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def compute(monkeys: dict[str, int | tuple[str, str, str]], monkey: str) -> int:
|
def compute(monkeys: dict[str, int | tuple[str, str, str]], monkey: str) -> int:
|
||||||
@@ -77,31 +78,31 @@ def invert(
|
|||||||
return monkeys
|
return monkeys
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
monkeys: dict[str, int | tuple[str, str, str]] = {}
|
monkeys: dict[str, int | tuple[str, str, str]] = {}
|
||||||
|
|
||||||
op_monkeys: set[str] = set()
|
op_monkeys: set[str] = set()
|
||||||
|
|
||||||
for line in lines:
|
for line in lines:
|
||||||
parts = line.split(":")
|
parts = line.split(":")
|
||||||
name = parts[0].strip()
|
name = parts[0].strip()
|
||||||
|
|
||||||
try:
|
try:
|
||||||
value = int(parts[1].strip())
|
value = int(parts[1].strip())
|
||||||
monkeys[name] = value
|
monkeys[name] = value
|
||||||
except ValueError:
|
except ValueError:
|
||||||
op1, ope, op2 = parts[1].strip().split()
|
op1, ope, op2 = parts[1].strip().split()
|
||||||
monkeys[name] = (op1, ope, op2)
|
monkeys[name] = (op1, ope, op2)
|
||||||
|
|
||||||
op_monkeys.add(name)
|
op_monkeys.add(name)
|
||||||
|
|
||||||
|
yield compute(monkeys.copy(), "root")
|
||||||
|
|
||||||
answer_1 = compute(monkeys.copy(), "root")
|
# assume the second operand of 'root' can be computed, and the first one depends on
|
||||||
print(f"answer 1 is {answer_1}")
|
# humn, which is the case is my input and the test input
|
||||||
|
assert isinstance(monkeys["root"], tuple)
|
||||||
# assume the second operand of 'root' can be computed, and the first one depends on
|
p1, _, p2 = monkeys["root"] # type: ignore
|
||||||
# humn, which is the case is my input and the test input
|
yield compute(invert(monkeys, "humn", compute(monkeys.copy(), p2)), "humn")
|
||||||
p1, _, p2 = monkeys["root"] # type: ignore
|
|
||||||
answer_2 = compute(invert(monkeys, "humn", compute(monkeys.copy(), p2)), "humn")
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,223 +1,243 @@
|
|||||||
import re
|
import re
|
||||||
import sys
|
from typing import Any, Callable, Iterator
|
||||||
from typing import Callable
|
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
VOID, EMPTY, WALL = 0, 1, 2
|
VOID, EMPTY, WALL = 0, 1, 2
|
||||||
TILE_FROM_CHAR = {" ": VOID, ".": EMPTY, "#": WALL}
|
TILE_FROM_CHAR = {" ": VOID, ".": EMPTY, "#": WALL}
|
||||||
|
|
||||||
SCORES = {"E": 0, "S": 1, "W": 2, "N": 3}
|
SCORES = {"E": 0, "S": 1, "W": 2, "N": 3}
|
||||||
|
|
||||||
|
|
||||||
board_map_s, direction_s = sys.stdin.read().split("\n\n")
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
board_map_s, direction_s = input.split("\n\n")
|
||||||
|
|
||||||
# board
|
# board
|
||||||
board_lines = board_map_s.splitlines()
|
board_lines = board_map_s.splitlines()
|
||||||
max_line = max(len(line) for line in board_lines)
|
max_line = max(len(line) for line in board_lines)
|
||||||
board = np.array(
|
board = np.array(
|
||||||
[
|
[
|
||||||
[TILE_FROM_CHAR[c] for c in row] + [VOID] * (max_line - len(row))
|
[TILE_FROM_CHAR[c] for c in row] + [VOID] * (max_line - len(row))
|
||||||
for row in board_map_s.splitlines()
|
for row in board_map_s.splitlines()
|
||||||
]
|
]
|
||||||
)
|
)
|
||||||
|
|
||||||
directions = [
|
directions = [
|
||||||
int(p1) if p2 else p1 for p1, p2 in re.findall(R"(([0-9])+|L|R)", direction_s)
|
int(p1) if p2 else p1
|
||||||
]
|
for p1, p2 in re.findall(R"(([0-9])+|L|R)", direction_s)
|
||||||
|
]
|
||||||
|
|
||||||
|
# find on each row and column the first and last non-void
|
||||||
|
row_first_non_void = np.argmax(board != VOID, axis=1)
|
||||||
|
row_last_non_void = (
|
||||||
|
board.shape[1] - np.argmax(board[:, ::-1] != VOID, axis=1) - 1
|
||||||
|
)
|
||||||
|
col_first_non_void = np.argmax(board != VOID, axis=0)
|
||||||
|
col_last_non_void = (
|
||||||
|
board.shape[0] - np.argmax(board[::-1, :] != VOID, axis=0) - 1
|
||||||
|
)
|
||||||
|
|
||||||
# find on each row and column the first and last non-void
|
faces = np.zeros_like(board)
|
||||||
row_first_non_void = np.argmax(board != VOID, axis=1)
|
size = np.gcd(board.shape[0], board.shape[1])
|
||||||
row_last_non_void = board.shape[1] - np.argmax(board[:, ::-1] != VOID, axis=1) - 1
|
for row in range(0, board.shape[0], size):
|
||||||
col_first_non_void = np.argmax(board != VOID, axis=0)
|
for col in range(row_first_non_void[row], row_last_non_void[row], size):
|
||||||
col_last_non_void = board.shape[0] - np.argmax(board[::-1, :] != VOID, axis=0) - 1
|
faces[row : row + size, col : col + size] = faces.max() + 1
|
||||||
|
|
||||||
|
SIZE = np.gcd(*board.shape)
|
||||||
|
|
||||||
faces = np.zeros_like(board)
|
# TODO: deduce this from the actual cube...
|
||||||
size = np.gcd(board.shape[0], board.shape[1])
|
faces_wrap: dict[int, dict[str, Callable[[int, int], tuple[int, int, str]]]]
|
||||||
for row in range(0, board.shape[0], size):
|
|
||||||
for col in range(row_first_non_void[row], row_last_non_void[row], size):
|
|
||||||
faces[row : row + size, col : col + size] = faces.max() + 1
|
|
||||||
|
|
||||||
SIZE = np.gcd(*board.shape)
|
if board.shape == (12, 16): # example
|
||||||
|
faces_wrap = {
|
||||||
|
1: {
|
||||||
|
"W": lambda y, x: (4, 4 + y, "S"), # 3N
|
||||||
|
"N": lambda y, x: (4, 11 - x, "S"), # 2N
|
||||||
|
"E": lambda y, x: (11 - y, 15, "W"), # 6E
|
||||||
|
},
|
||||||
|
2: {
|
||||||
|
"W": lambda y, x: (11, 19 - y, "N"), # 6S
|
||||||
|
"N": lambda y, x: (0, 11 - y, "S"), # 1N
|
||||||
|
"S": lambda y, x: (11, 11 - x, "N"), # 5S
|
||||||
|
},
|
||||||
|
3: {
|
||||||
|
"N": lambda y, x: (x - 4, 8, "E"), # 1W
|
||||||
|
"S": lambda y, x: (15 - x, 8, "E"), # 5W
|
||||||
|
},
|
||||||
|
4: {"E": lambda y, x: (8, 19 - y, "S")}, # 6N
|
||||||
|
5: {
|
||||||
|
"W": lambda y, x: (7, 15 - y, "N"), # 3S
|
||||||
|
"S": lambda y, x: (7, 11 - x, "N"), # 2S
|
||||||
|
},
|
||||||
|
6: {
|
||||||
|
"N": lambda y, x: (19 - x, 11, "W"), # 4E
|
||||||
|
"E": lambda y, x: (11 - y, 11, "W"), # 1E
|
||||||
|
"S": lambda y, x: (19 - x, 0, "E"), # 2W
|
||||||
|
},
|
||||||
|
}
|
||||||
|
|
||||||
# TODO: deduce this from the actual cube...
|
|
||||||
faces_wrap: dict[int, dict[str, Callable[[int, int], tuple[int, int, str]]]]
|
|
||||||
|
|
||||||
if board.shape == (12, 16): # example
|
|
||||||
faces_wrap = {
|
|
||||||
1: {
|
|
||||||
"W": lambda y, x: (4, 4 + y, "S"), # 3N
|
|
||||||
"N": lambda y, x: (4, 11 - x, "S"), # 2N
|
|
||||||
"E": lambda y, x: (11 - y, 15, "W"), # 6E
|
|
||||||
},
|
|
||||||
2: {
|
|
||||||
"W": lambda y, x: (11, 19 - y, "N"), # 6S
|
|
||||||
"N": lambda y, x: (0, 11 - y, "S"), # 1N
|
|
||||||
"S": lambda y, x: (11, 11 - x, "N"), # 5S
|
|
||||||
},
|
|
||||||
3: {
|
|
||||||
"N": lambda y, x: (x - 4, 8, "E"), # 1W
|
|
||||||
"S": lambda y, x: (15 - x, 8, "E"), # 5W
|
|
||||||
},
|
|
||||||
4: {"E": lambda y, x: (8, 19 - y, "S")}, # 6N
|
|
||||||
5: {
|
|
||||||
"W": lambda y, x: (7, 15 - y, "N"), # 3S
|
|
||||||
"S": lambda y, x: (7, 11 - x, "N"), # 2S
|
|
||||||
},
|
|
||||||
6: {
|
|
||||||
"N": lambda y, x: (19 - x, 11, "W"), # 4E
|
|
||||||
"E": lambda y, x: (11 - y, 11, "W"), # 1E
|
|
||||||
"S": lambda y, x: (19 - x, 0, "E"), # 2W
|
|
||||||
},
|
|
||||||
}
|
|
||||||
|
|
||||||
else:
|
|
||||||
faces_wrap = {
|
|
||||||
1: {
|
|
||||||
"W": lambda y, x: (3 * SIZE - y - 1, 0, "E"), # 4W
|
|
||||||
"N": lambda y, x: (2 * SIZE + x, 0, "E"), # 6W
|
|
||||||
},
|
|
||||||
2: {
|
|
||||||
"N": lambda y, x: (4 * SIZE - 1, x - 2 * SIZE, "N"), # 6S
|
|
||||||
"E": lambda y, x: (3 * SIZE - y - 1, 2 * SIZE - 1, "W"), # 5E
|
|
||||||
"S": lambda y, x: (x - SIZE, 2 * SIZE - 1, "W"), # 3E
|
|
||||||
},
|
|
||||||
3: {
|
|
||||||
"W": lambda y, x: (2 * SIZE, y - SIZE, "S"), # 4N
|
|
||||||
"E": lambda y, x: (SIZE - 1, SIZE + y, "N"), # 2S
|
|
||||||
},
|
|
||||||
4: {
|
|
||||||
"W": lambda y, x: (3 * SIZE - y - 1, SIZE, "E"), # 1W
|
|
||||||
"N": lambda y, x: (SIZE + x, SIZE, "E"), # 3W
|
|
||||||
},
|
|
||||||
5: {
|
|
||||||
"E": lambda y, x: (3 * SIZE - y - 1, 3 * SIZE - 1, "W"), # 2E
|
|
||||||
"S": lambda y, x: (2 * SIZE + x, SIZE - 1, "W"), # 6E
|
|
||||||
},
|
|
||||||
6: {
|
|
||||||
"W": lambda y, x: (0, y - 2 * SIZE, "S"), # 1N
|
|
||||||
"E": lambda y, x: (3 * SIZE - 1, y - 2 * SIZE, "N"), # 5S
|
|
||||||
"S": lambda y, x: (0, x + 2 * SIZE, "S"), # 2N
|
|
||||||
},
|
|
||||||
}
|
|
||||||
|
|
||||||
|
|
||||||
def wrap_part_1(y0: int, x0: int, r0: str) -> tuple[int, int, str]:
|
|
||||||
if r0 == "E":
|
|
||||||
return y0, row_first_non_void[y0], r0
|
|
||||||
elif r0 == "S":
|
|
||||||
return col_first_non_void[x0], x0, r0
|
|
||||||
elif r0 == "W":
|
|
||||||
return y0, row_last_non_void[y0], r0
|
|
||||||
elif r0 == "N":
|
|
||||||
return col_last_non_void[x0], x0, r0
|
|
||||||
|
|
||||||
assert False
|
|
||||||
|
|
||||||
|
|
||||||
def wrap_part_2(y0: int, x0: int, r0: str) -> tuple[int, int, str]:
|
|
||||||
cube = faces[y0, x0]
|
|
||||||
assert r0 in faces_wrap[cube]
|
|
||||||
return faces_wrap[cube][r0](y0, x0)
|
|
||||||
|
|
||||||
|
|
||||||
def run(wrap: Callable[[int, int, str], tuple[int, int, str]]) -> tuple[int, int, str]:
|
|
||||||
y0 = 0
|
|
||||||
x0 = np.where(board[0] == EMPTY)[0][0]
|
|
||||||
r0 = "E"
|
|
||||||
|
|
||||||
for direction in directions:
|
|
||||||
if isinstance(direction, int):
|
|
||||||
while direction > 0:
|
|
||||||
if r0 == "E":
|
|
||||||
xi = np.where(board[y0, x0 + 1 : x0 + direction + 1] == WALL)[0]
|
|
||||||
if len(xi):
|
|
||||||
x0 = x0 + xi[0]
|
|
||||||
direction = 0
|
|
||||||
elif (
|
|
||||||
x0 + direction < board.shape[1]
|
|
||||||
and board[y0, x0 + direction] == EMPTY
|
|
||||||
):
|
|
||||||
x0 = x0 + direction
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
|
||||||
if board[y0_t, x0_t] == WALL:
|
|
||||||
x0 = row_last_non_void[y0]
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
direction = direction - (row_last_non_void[y0] - x0) - 1
|
|
||||||
y0, x0, r0 = y0_t, x0_t, r0_t
|
|
||||||
elif r0 == "S":
|
|
||||||
yi = np.where(board[y0 + 1 : y0 + direction + 1, x0] == WALL)[0]
|
|
||||||
if len(yi):
|
|
||||||
y0 = y0 + yi[0]
|
|
||||||
direction = 0
|
|
||||||
elif (
|
|
||||||
y0 + direction < board.shape[0]
|
|
||||||
and board[y0 + direction, x0] == EMPTY
|
|
||||||
):
|
|
||||||
y0 = y0 + direction
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
|
||||||
if board[y0_t, x0_t] == WALL:
|
|
||||||
y0 = col_last_non_void[x0]
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
direction = direction - (col_last_non_void[x0] - y0) - 1
|
|
||||||
y0, x0, r0 = y0_t, x0_t, r0_t
|
|
||||||
elif r0 == "W":
|
|
||||||
left = max(x0 - direction - 1, 0)
|
|
||||||
xi = np.where(board[y0, left:x0] == WALL)[0]
|
|
||||||
if len(xi):
|
|
||||||
x0 = left + xi[-1] + 1
|
|
||||||
direction = 0
|
|
||||||
elif x0 - direction >= 0 and board[y0, x0 - direction] == EMPTY:
|
|
||||||
x0 = x0 - direction
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
|
||||||
if board[y0_t, x0_t] == WALL:
|
|
||||||
x0 = row_first_non_void[y0]
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
direction = direction - (x0 - row_first_non_void[y0]) - 1
|
|
||||||
y0, x0, r0 = y0_t, x0_t, r0_t
|
|
||||||
elif r0 == "N":
|
|
||||||
top = max(y0 - direction - 1, 0)
|
|
||||||
yi = np.where(board[top:y0, x0] == WALL)[0]
|
|
||||||
if len(yi):
|
|
||||||
y0 = top + yi[-1] + 1
|
|
||||||
direction = 0
|
|
||||||
elif y0 - direction >= 0 and board[y0 - direction, x0] == EMPTY:
|
|
||||||
y0 = y0 - direction
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
|
||||||
if board[y0_t, x0_t] == WALL:
|
|
||||||
y0 = col_first_non_void[x0]
|
|
||||||
direction = 0
|
|
||||||
else:
|
|
||||||
direction = direction - (y0 - col_first_non_void[x0]) - 1
|
|
||||||
y0, x0, r0 = y0_t, x0_t, r0_t
|
|
||||||
else:
|
else:
|
||||||
r0 = {
|
faces_wrap = {
|
||||||
"E": {"L": "N", "R": "S"},
|
1: {
|
||||||
"N": {"L": "W", "R": "E"},
|
"W": lambda y, x: (3 * SIZE - y - 1, 0, "E"), # 4W
|
||||||
"W": {"L": "S", "R": "N"},
|
"N": lambda y, x: (2 * SIZE + x, 0, "E"), # 6W
|
||||||
"S": {"L": "E", "R": "W"},
|
},
|
||||||
}[r0][direction]
|
2: {
|
||||||
|
"N": lambda y, x: (4 * SIZE - 1, x - 2 * SIZE, "N"), # 6S
|
||||||
|
"E": lambda y, x: (3 * SIZE - y - 1, 2 * SIZE - 1, "W"), # 5E
|
||||||
|
"S": lambda y, x: (x - SIZE, 2 * SIZE - 1, "W"), # 3E
|
||||||
|
},
|
||||||
|
3: {
|
||||||
|
"W": lambda y, x: (2 * SIZE, y - SIZE, "S"), # 4N
|
||||||
|
"E": lambda y, x: (SIZE - 1, SIZE + y, "N"), # 2S
|
||||||
|
},
|
||||||
|
4: {
|
||||||
|
"W": lambda y, x: (3 * SIZE - y - 1, SIZE, "E"), # 1W
|
||||||
|
"N": lambda y, x: (SIZE + x, SIZE, "E"), # 3W
|
||||||
|
},
|
||||||
|
5: {
|
||||||
|
"E": lambda y, x: (3 * SIZE - y - 1, 3 * SIZE - 1, "W"), # 2E
|
||||||
|
"S": lambda y, x: (2 * SIZE + x, SIZE - 1, "W"), # 6E
|
||||||
|
},
|
||||||
|
6: {
|
||||||
|
"W": lambda y, x: (0, y - 2 * SIZE, "S"), # 1N
|
||||||
|
"E": lambda y, x: (3 * SIZE - 1, y - 2 * SIZE, "N"), # 5S
|
||||||
|
"S": lambda y, x: (0, x + 2 * SIZE, "S"), # 2N
|
||||||
|
},
|
||||||
|
}
|
||||||
|
|
||||||
return y0, x0, r0
|
def wrap_part_1(y0: int, x0: int, r0: str) -> tuple[int, int, str]:
|
||||||
|
if r0 == "E":
|
||||||
|
return y0, row_first_non_void[y0], r0
|
||||||
|
elif r0 == "S":
|
||||||
|
return col_first_non_void[x0], x0, r0
|
||||||
|
elif r0 == "W":
|
||||||
|
return y0, row_last_non_void[y0], r0
|
||||||
|
elif r0 == "N":
|
||||||
|
return col_last_non_void[x0], x0, r0
|
||||||
|
|
||||||
|
assert False
|
||||||
|
|
||||||
y1, x1, r1 = run(wrap_part_1)
|
def wrap_part_2(y0: int, x0: int, r0: str) -> tuple[int, int, str]:
|
||||||
answer_1 = 1000 * (1 + y1) + 4 * (1 + x1) + SCORES[r1]
|
cube = faces[y0, x0]
|
||||||
print(f"answer 1 is {answer_1}")
|
assert r0 in faces_wrap[cube]
|
||||||
|
return faces_wrap[cube][r0](y0, x0)
|
||||||
|
|
||||||
y2, x2, r2 = run(wrap_part_2)
|
def run(
|
||||||
answer_2 = 1000 * (1 + y2) + 4 * (1 + x2) + SCORES[r2]
|
wrap: Callable[[int, int, str], tuple[int, int, str]],
|
||||||
print(f"answer 2 is {answer_2}")
|
) -> tuple[int, int, str]:
|
||||||
|
y0 = 0
|
||||||
|
x0 = np.where(board[0] == EMPTY)[0][0]
|
||||||
|
r0 = "E"
|
||||||
|
|
||||||
|
for direction in directions:
|
||||||
|
if isinstance(direction, int):
|
||||||
|
while direction > 0:
|
||||||
|
if r0 == "E":
|
||||||
|
xi = np.where(
|
||||||
|
board[y0, x0 + 1 : x0 + direction + 1] == WALL
|
||||||
|
)[0]
|
||||||
|
if len(xi):
|
||||||
|
x0 = x0 + xi[0]
|
||||||
|
direction = 0
|
||||||
|
elif (
|
||||||
|
x0 + direction < board.shape[1]
|
||||||
|
and board[y0, x0 + direction] == EMPTY
|
||||||
|
):
|
||||||
|
x0 = x0 + direction
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
||||||
|
if board[y0_t, x0_t] == WALL:
|
||||||
|
x0 = row_last_non_void[y0]
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
direction = (
|
||||||
|
direction - (row_last_non_void[y0] - x0) - 1
|
||||||
|
)
|
||||||
|
y0, x0, r0 = y0_t, x0_t, r0_t
|
||||||
|
elif r0 == "S":
|
||||||
|
yi = np.where(
|
||||||
|
board[y0 + 1 : y0 + direction + 1, x0] == WALL
|
||||||
|
)[0]
|
||||||
|
if len(yi):
|
||||||
|
y0 = y0 + yi[0]
|
||||||
|
direction = 0
|
||||||
|
elif (
|
||||||
|
y0 + direction < board.shape[0]
|
||||||
|
and board[y0 + direction, x0] == EMPTY
|
||||||
|
):
|
||||||
|
y0 = y0 + direction
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
||||||
|
if board[y0_t, x0_t] == WALL:
|
||||||
|
y0 = col_last_non_void[x0]
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
direction = (
|
||||||
|
direction - (col_last_non_void[x0] - y0) - 1
|
||||||
|
)
|
||||||
|
y0, x0, r0 = y0_t, x0_t, r0_t
|
||||||
|
elif r0 == "W":
|
||||||
|
left = max(x0 - direction - 1, 0)
|
||||||
|
xi = np.where(board[y0, left:x0] == WALL)[0]
|
||||||
|
if len(xi):
|
||||||
|
x0 = left + xi[-1] + 1
|
||||||
|
direction = 0
|
||||||
|
elif (
|
||||||
|
x0 - direction >= 0
|
||||||
|
and board[y0, x0 - direction] == EMPTY
|
||||||
|
):
|
||||||
|
x0 = x0 - direction
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
||||||
|
if board[y0_t, x0_t] == WALL:
|
||||||
|
x0 = row_first_non_void[y0]
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
direction = (
|
||||||
|
direction - (x0 - row_first_non_void[y0]) - 1
|
||||||
|
)
|
||||||
|
y0, x0, r0 = y0_t, x0_t, r0_t
|
||||||
|
elif r0 == "N":
|
||||||
|
top = max(y0 - direction - 1, 0)
|
||||||
|
yi = np.where(board[top:y0, x0] == WALL)[0]
|
||||||
|
if len(yi):
|
||||||
|
y0 = top + yi[-1] + 1
|
||||||
|
direction = 0
|
||||||
|
elif (
|
||||||
|
y0 - direction >= 0
|
||||||
|
and board[y0 - direction, x0] == EMPTY
|
||||||
|
):
|
||||||
|
y0 = y0 - direction
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
y0_t, x0_t, r0_t = wrap(y0, x0, r0)
|
||||||
|
if board[y0_t, x0_t] == WALL:
|
||||||
|
y0 = col_first_non_void[x0]
|
||||||
|
direction = 0
|
||||||
|
else:
|
||||||
|
direction = (
|
||||||
|
direction - (y0 - col_first_non_void[x0]) - 1
|
||||||
|
)
|
||||||
|
y0, x0, r0 = y0_t, x0_t, r0_t
|
||||||
|
else:
|
||||||
|
r0 = {
|
||||||
|
"E": {"L": "N", "R": "S"},
|
||||||
|
"N": {"L": "W", "R": "E"},
|
||||||
|
"W": {"L": "S", "R": "N"},
|
||||||
|
"S": {"L": "E", "R": "W"},
|
||||||
|
}[r0][direction]
|
||||||
|
|
||||||
|
return y0, x0, r0
|
||||||
|
|
||||||
|
y1, x1, r1 = run(wrap_part_1)
|
||||||
|
yield 1000 * (1 + y1) + 4 * (1 + x1) + SCORES[r1]
|
||||||
|
|
||||||
|
y2, x2, r2 = run(wrap_part_2)
|
||||||
|
yield 1000 * (1 + y2) + 4 * (1 + x2) + SCORES[r2]
|
||||||
|
|||||||
@@ -1,6 +1,8 @@
|
|||||||
import itertools
|
import itertools
|
||||||
import sys
|
|
||||||
from collections import defaultdict
|
from collections import defaultdict
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
Directions = list[
|
Directions = list[
|
||||||
tuple[
|
tuple[
|
||||||
@@ -18,22 +20,10 @@ DIRECTIONS: Directions = [
|
|||||||
|
|
||||||
|
|
||||||
def min_max_yx(positions: set[tuple[int, int]]) -> tuple[int, int, int, int]:
|
def min_max_yx(positions: set[tuple[int, int]]) -> tuple[int, int, int, int]:
|
||||||
ys, xs = {y for y, x in positions}, {x for y, x in positions}
|
ys, xs = {y for y, _x in positions}, {x for _y, x in positions}
|
||||||
return min(ys), min(xs), max(ys), max(xs)
|
return min(ys), min(xs), max(ys), max(xs)
|
||||||
|
|
||||||
|
|
||||||
def print_positions(positions: set[tuple[int, int]]):
|
|
||||||
min_y, min_x, max_y, max_x = min_max_yx(positions)
|
|
||||||
print(
|
|
||||||
"\n".join(
|
|
||||||
"".join(
|
|
||||||
"#" if (y, x) in positions else "." for x in range(min_x - 1, max_x + 2)
|
|
||||||
)
|
|
||||||
for y in range(min_y - 1, max_y + 2)
|
|
||||||
)
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
def round(
|
def round(
|
||||||
positions: set[tuple[int, int]],
|
positions: set[tuple[int, int]],
|
||||||
directions: Directions,
|
directions: Directions,
|
||||||
@@ -69,35 +59,38 @@ def round(
|
|||||||
directions.append(directions.pop(0))
|
directions.append(directions.pop(0))
|
||||||
|
|
||||||
|
|
||||||
POSITIONS = {
|
class Solver(BaseSolver):
|
||||||
(i, j)
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
for i, row in enumerate(sys.stdin.read().splitlines())
|
POSITIONS = {
|
||||||
for j, col in enumerate(row)
|
(i, j)
|
||||||
if col == "#"
|
for i, row in enumerate(input.splitlines())
|
||||||
}
|
for j, col in enumerate(row)
|
||||||
|
if col == "#"
|
||||||
|
}
|
||||||
|
|
||||||
# === part 1 ===
|
# === part 1 ===
|
||||||
|
|
||||||
p1, d1 = POSITIONS.copy(), DIRECTIONS.copy()
|
p1, d1 = POSITIONS.copy(), DIRECTIONS.copy()
|
||||||
for r in range(10):
|
for _ in range(10):
|
||||||
round(p1, d1)
|
round(p1, d1)
|
||||||
|
|
||||||
min_y, min_x, max_y, max_x = min_max_yx(p1)
|
min_y, min_x, max_y, max_x = min_max_yx(p1)
|
||||||
answer_1 = sum(
|
yield sum(
|
||||||
(y, x) not in p1 for y in range(min_y, max_y + 1) for x in range(min_x, max_x + 1)
|
(y, x) not in p1
|
||||||
)
|
for y in range(min_y, max_y + 1)
|
||||||
print(f"answer 1 is {answer_1}")
|
for x in range(min_x, max_x + 1)
|
||||||
|
)
|
||||||
|
|
||||||
# === part 2 ===
|
# === part 2 ===
|
||||||
|
|
||||||
p2, d2 = POSITIONS.copy(), DIRECTIONS.copy()
|
p2, d2 = POSITIONS.copy(), DIRECTIONS.copy()
|
||||||
answer_2 = 0
|
answer_2 = 0
|
||||||
while True:
|
while True:
|
||||||
answer_2 += 1
|
answer_2 += 1
|
||||||
backup = p2.copy()
|
backup = p2.copy()
|
||||||
round(p2, d2)
|
round(p2, d2)
|
||||||
|
|
||||||
if backup == p2:
|
if backup == p2:
|
||||||
break
|
break
|
||||||
|
|
||||||
print(f"answer 2 is {answer_2}")
|
yield answer_2
|
||||||
|
|||||||
@@ -1,98 +1,117 @@
|
|||||||
import heapq
|
import heapq
|
||||||
import math
|
import math
|
||||||
import sys
|
|
||||||
from collections import defaultdict
|
from collections import defaultdict
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
winds = {
|
|
||||||
(i - 1, j - 1, lines[i][j])
|
|
||||||
for i in range(1, len(lines) - 1)
|
|
||||||
for j in range(1, len(lines[i]) - 1)
|
|
||||||
if lines[i][j] != "."
|
|
||||||
}
|
|
||||||
|
|
||||||
n_rows, n_cols = len(lines) - 2, len(lines[0]) - 2
|
|
||||||
CYCLE = math.lcm(n_rows, n_cols)
|
|
||||||
|
|
||||||
east_winds = [{j for j in range(n_cols) if (i, j, ">") in winds} for i in range(n_rows)]
|
|
||||||
west_winds = [{j for j in range(n_cols) if (i, j, "<") in winds} for i in range(n_rows)]
|
|
||||||
north_winds = [
|
|
||||||
{i for i in range(n_rows) if (i, j, "^") in winds} for j in range(n_cols)
|
|
||||||
]
|
|
||||||
south_winds = [
|
|
||||||
{i for i in range(n_rows) if (i, j, "v") in winds} for j in range(n_cols)
|
|
||||||
]
|
|
||||||
|
|
||||||
|
|
||||||
def run(start: tuple[int, int], start_cycle: int, end: tuple[int, int]):
|
class Solver(BaseSolver):
|
||||||
def heuristic(y: int, x: int) -> int:
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
return abs(end[0] - y) + abs(end[1] - x)
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
# (distance + heuristic, distance, (start_pos, cycle))
|
winds = {
|
||||||
queue = [(heuristic(start[0], start[1]), 0, ((start[0], start[1]), start_cycle))]
|
(i - 1, j - 1, lines[i][j])
|
||||||
visited: set[tuple[tuple[int, int], int]] = set()
|
for i in range(1, len(lines) - 1)
|
||||||
distances: dict[tuple[int, int], dict[int, int]] = defaultdict(lambda: {})
|
for j in range(1, len(lines[i]) - 1)
|
||||||
|
if lines[i][j] != "."
|
||||||
|
}
|
||||||
|
|
||||||
while queue:
|
n_rows, n_cols = len(lines) - 2, len(lines[0]) - 2
|
||||||
_, distance, ((y, x), cycle) = heapq.heappop(queue)
|
CYCLE = math.lcm(n_rows, n_cols)
|
||||||
|
|
||||||
if ((y, x), cycle) in visited:
|
east_winds = [
|
||||||
continue
|
{j for j in range(n_cols) if (i, j, ">") in winds} for i in range(n_rows)
|
||||||
|
]
|
||||||
|
west_winds = [
|
||||||
|
{j for j in range(n_cols) if (i, j, "<") in winds} for i in range(n_rows)
|
||||||
|
]
|
||||||
|
north_winds = [
|
||||||
|
{i for i in range(n_rows) if (i, j, "^") in winds} for j in range(n_cols)
|
||||||
|
]
|
||||||
|
south_winds = [
|
||||||
|
{i for i in range(n_rows) if (i, j, "v") in winds} for j in range(n_cols)
|
||||||
|
]
|
||||||
|
|
||||||
distances[y, x][cycle] = distance
|
def run(start: tuple[int, int], start_cycle: int, end: tuple[int, int]):
|
||||||
|
def heuristic(y: int, x: int) -> int:
|
||||||
|
return abs(end[0] - y) + abs(end[1] - x)
|
||||||
|
|
||||||
visited.add(((y, x), cycle))
|
# (distance + heuristic, distance, (start_pos, cycle))
|
||||||
|
queue = [
|
||||||
|
(heuristic(start[0], start[1]), 0, ((start[0], start[1]), start_cycle))
|
||||||
|
]
|
||||||
|
visited: set[tuple[tuple[int, int], int]] = set()
|
||||||
|
distances: dict[tuple[int, int], dict[int, int]] = defaultdict(lambda: {})
|
||||||
|
|
||||||
if (y, x) == (end[0], end[1]):
|
while queue:
|
||||||
break
|
_, distance, ((y, x), cycle) = heapq.heappop(queue)
|
||||||
|
|
||||||
for dy, dx in (0, 0), (-1, 0), (1, 0), (0, -1), (0, 1):
|
if ((y, x), cycle) in visited:
|
||||||
ty = y + dy
|
|
||||||
tx = x + dx
|
|
||||||
|
|
||||||
n_cycle = (cycle + 1) % CYCLE
|
|
||||||
|
|
||||||
if (ty, tx) == end:
|
|
||||||
heapq.heappush(queue, (distance + 1, distance + 1, ((ty, tx), n_cycle)))
|
|
||||||
break
|
|
||||||
|
|
||||||
if ((ty, tx), n_cycle) in visited:
|
|
||||||
continue
|
|
||||||
|
|
||||||
if (ty, tx) != start and (ty < 0 or tx < 0 or ty >= n_rows or tx >= n_cols):
|
|
||||||
continue
|
|
||||||
|
|
||||||
if (ty, tx) != start:
|
|
||||||
if (ty - n_cycle) % n_rows in south_winds[tx]:
|
|
||||||
continue
|
|
||||||
if (ty + n_cycle) % n_rows in north_winds[tx]:
|
|
||||||
continue
|
|
||||||
if (tx + n_cycle) % n_cols in west_winds[ty]:
|
|
||||||
continue
|
|
||||||
if (tx - n_cycle) % n_cols in east_winds[ty]:
|
|
||||||
continue
|
continue
|
||||||
|
|
||||||
heapq.heappush(
|
distances[y, x][cycle] = distance
|
||||||
queue,
|
|
||||||
((heuristic(ty, tx) + distance + 1, distance + 1, ((ty, tx), n_cycle))),
|
|
||||||
)
|
|
||||||
|
|
||||||
return distances, next(iter(distances[end].values()))
|
visited.add(((y, x), cycle))
|
||||||
|
|
||||||
|
if (y, x) == (end[0], end[1]):
|
||||||
|
break
|
||||||
|
|
||||||
start = (
|
for dy, dx in (0, 0), (-1, 0), (1, 0), (0, -1), (0, 1):
|
||||||
-1,
|
ty = y + dy
|
||||||
next(j for j in range(1, len(lines[0]) - 1) if lines[0][j] == ".") - 1,
|
tx = x + dx
|
||||||
)
|
|
||||||
end = (
|
|
||||||
n_rows,
|
|
||||||
next(j for j in range(1, len(lines[-1]) - 1) if lines[-1][j] == ".") - 1,
|
|
||||||
)
|
|
||||||
|
|
||||||
distances_1, forward_1 = run(start, 0, end)
|
n_cycle = (cycle + 1) % CYCLE
|
||||||
print(f"answer 1 is {forward_1}")
|
|
||||||
|
|
||||||
distances_2, return_1 = run(end, next(iter(distances_1[end].keys())), start)
|
if (ty, tx) == end:
|
||||||
distances_3, forward_2 = run(start, next(iter(distances_2[start].keys())), end)
|
heapq.heappush(
|
||||||
print(f"answer 2 is {forward_1 + return_1 + forward_2}")
|
queue, (distance + 1, distance + 1, ((ty, tx), n_cycle))
|
||||||
|
)
|
||||||
|
break
|
||||||
|
|
||||||
|
if ((ty, tx), n_cycle) in visited:
|
||||||
|
continue
|
||||||
|
|
||||||
|
if (ty, tx) != start and (
|
||||||
|
ty < 0 or tx < 0 or ty >= n_rows or tx >= n_cols
|
||||||
|
):
|
||||||
|
continue
|
||||||
|
|
||||||
|
if (ty, tx) != start:
|
||||||
|
if (ty - n_cycle) % n_rows in south_winds[tx]:
|
||||||
|
continue
|
||||||
|
if (ty + n_cycle) % n_rows in north_winds[tx]:
|
||||||
|
continue
|
||||||
|
if (tx + n_cycle) % n_cols in west_winds[ty]:
|
||||||
|
continue
|
||||||
|
if (tx - n_cycle) % n_cols in east_winds[ty]:
|
||||||
|
continue
|
||||||
|
|
||||||
|
heapq.heappush(
|
||||||
|
queue,
|
||||||
|
(
|
||||||
|
(
|
||||||
|
heuristic(ty, tx) + distance + 1,
|
||||||
|
distance + 1,
|
||||||
|
((ty, tx), n_cycle),
|
||||||
|
)
|
||||||
|
),
|
||||||
|
)
|
||||||
|
|
||||||
|
return distances, next(iter(distances[end].values()))
|
||||||
|
|
||||||
|
start = (
|
||||||
|
-1,
|
||||||
|
next(j for j in range(1, len(lines[0]) - 1) if lines[0][j] == ".") - 1,
|
||||||
|
)
|
||||||
|
end = (
|
||||||
|
n_rows,
|
||||||
|
next(j for j in range(1, len(lines[-1]) - 1) if lines[-1][j] == ".") - 1,
|
||||||
|
)
|
||||||
|
|
||||||
|
distances_1, forward_1 = run(start, 0, end)
|
||||||
|
yield forward_1
|
||||||
|
|
||||||
|
distances_2, return_1 = run(end, next(iter(distances_1[end].keys())), start)
|
||||||
|
_distances_3, forward_2 = run(start, next(iter(distances_2[start].keys())), end)
|
||||||
|
yield forward_1 + return_1 + forward_2
|
||||||
|
|||||||
@@ -1,27 +1,28 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
coeffs = {"2": 2, "1": 1, "0": 0, "-": -1, "=": -2}
|
|
||||||
|
|
||||||
|
|
||||||
def snafu2number(number: str) -> int:
|
class Solver(BaseSolver):
|
||||||
value = 0
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
for c in number:
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
value *= 5
|
|
||||||
value += coeffs[c]
|
|
||||||
return value
|
|
||||||
|
|
||||||
|
coeffs = {"2": 2, "1": 1, "0": 0, "-": -1, "=": -2}
|
||||||
|
|
||||||
def number2snafu(number: int) -> str:
|
def snafu2number(number: str) -> int:
|
||||||
values = ["0", "1", "2", "=", "-"]
|
value = 0
|
||||||
res = ""
|
for c in number:
|
||||||
while number > 0:
|
value *= 5
|
||||||
mod = number % 5
|
value += coeffs[c]
|
||||||
res = res + values[mod]
|
return value
|
||||||
number = number // 5 + int(mod >= 3)
|
|
||||||
return "".join(reversed(res))
|
|
||||||
|
|
||||||
|
def number2snafu(number: int) -> str:
|
||||||
|
values = ["0", "1", "2", "=", "-"]
|
||||||
|
res = ""
|
||||||
|
while number > 0:
|
||||||
|
mod = number % 5
|
||||||
|
res = res + values[mod]
|
||||||
|
number = number // 5 + int(mod >= 3)
|
||||||
|
return "".join(reversed(res))
|
||||||
|
|
||||||
answer_1 = number2snafu(sum(map(snafu2number, lines)))
|
yield number2snafu(sum(map(snafu2number, lines)))
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|||||||
@@ -1,23 +1,28 @@
|
|||||||
import string
|
import string
|
||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = [line.strip() for line in sys.stdin.readlines()]
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# extract content of each part
|
|
||||||
parts = [(set(line[: len(line) // 2]), set(line[len(line) // 2 :])) for line in lines]
|
|
||||||
|
|
||||||
# priorities
|
class Solver(BaseSolver):
|
||||||
priorities = {c: i + 1 for i, c in enumerate(string.ascii_letters)}
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
# part 1
|
# extract content of each part
|
||||||
part1 = sum(priorities[c] for p1, p2 in parts for c in p1.intersection(p2))
|
parts = [
|
||||||
print(f"answer 1 is {part1}")
|
(set(line[: len(line) // 2]), set(line[len(line) // 2 :])) for line in lines
|
||||||
|
]
|
||||||
|
|
||||||
# part 2
|
# priorities
|
||||||
n_per_group = 3
|
priorities = {c: i + 1 for i, c in enumerate(string.ascii_letters)}
|
||||||
part2 = sum(
|
|
||||||
priorities[c]
|
# part 1
|
||||||
for i in range(0, len(lines), n_per_group)
|
yield sum(priorities[c] for p1, p2 in parts for c in p1.intersection(p2))
|
||||||
for c in set(lines[i]).intersection(*lines[i + 1 : i + n_per_group])
|
|
||||||
)
|
# part 2
|
||||||
print(f"answer 2 is {part2}")
|
n_per_group = 3
|
||||||
|
yield sum(
|
||||||
|
priorities[c]
|
||||||
|
for i in range(0, len(lines), n_per_group)
|
||||||
|
for c in set(lines[i]).intersection(*lines[i + 1 : i + n_per_group])
|
||||||
|
)
|
||||||
|
|||||||
@@ -1,6 +1,6 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = [line.strip() for line in sys.stdin.readlines()]
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def make_range(value: str) -> set[int]:
|
def make_range(value: str) -> set[int]:
|
||||||
@@ -8,10 +8,13 @@ def make_range(value: str) -> set[int]:
|
|||||||
return set(range(int(parts[0]), int(parts[1]) + 1))
|
return set(range(int(parts[0]), int(parts[1]) + 1))
|
||||||
|
|
||||||
|
|
||||||
sections = [tuple(make_range(part) for part in line.split(",")) for line in lines]
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
answer_1 = sum(s1.issubset(s2) or s2.issubset(s1) for s1, s2 in sections)
|
sections = [
|
||||||
print(f"answer 1 is {answer_1}")
|
tuple(make_range(part) for part in line.split(",")) for line in lines
|
||||||
|
]
|
||||||
|
|
||||||
answer_2 = sum(bool(s1.intersection(s2)) for s1, s2 in sections)
|
yield sum(s1.issubset(s2) or s2.issubset(s1) for s1, s2 in sections)
|
||||||
print(f"answer 1 is {answer_2}")
|
yield sum(bool(s1.intersection(s2)) for s1, s2 in sections)
|
||||||
|
|||||||
@@ -1,41 +1,43 @@
|
|||||||
import copy
|
import copy
|
||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
blocks_s, moves_s = (part.splitlines() for part in sys.stdin.read().split("\n\n"))
|
from ..base import BaseSolver
|
||||||
|
|
||||||
blocks: dict[str, list[str]] = {stack: [] for stack in blocks_s[-1].split()}
|
|
||||||
|
|
||||||
# this codes assumes that the lines are regular, i.e., 4 characters per "crate" in the
|
class Solver(BaseSolver):
|
||||||
# form of '[X] ' (including the trailing space)
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
#
|
blocks_s, moves_s = (part.splitlines() for part in input.split("\n\n"))
|
||||||
for block in blocks_s[-2::-1]:
|
|
||||||
for stack, index in zip(blocks, range(0, len(block), 4)):
|
|
||||||
crate = block[index + 1 : index + 2].strip()
|
|
||||||
|
|
||||||
if crate:
|
blocks: dict[str, list[str]] = {stack: [] for stack in blocks_s[-1].split()}
|
||||||
blocks[stack].append(crate)
|
|
||||||
|
|
||||||
# part 1 - deep copy for part 2
|
# this codes assumes that the lines are regular, i.e., 4 characters per "crate" in the
|
||||||
blocks_1 = copy.deepcopy(blocks)
|
# form of '[X] ' (including the trailing space)
|
||||||
|
#
|
||||||
|
for block in blocks_s[-2::-1]:
|
||||||
|
for stack, index in zip(blocks, range(0, len(block), 4)):
|
||||||
|
crate = block[index + 1 : index + 2].strip()
|
||||||
|
|
||||||
for move in moves_s:
|
if crate:
|
||||||
_, count_s, _, from_, _, to_ = move.strip().split()
|
blocks[stack].append(crate)
|
||||||
|
|
||||||
for _i in range(int(count_s)):
|
# part 1 - deep copy for part 2
|
||||||
blocks_1[to_].append(blocks_1[from_].pop())
|
blocks_1 = copy.deepcopy(blocks)
|
||||||
|
|
||||||
# part 2
|
for move in moves_s:
|
||||||
blocks_2 = copy.deepcopy(blocks)
|
_, count_s, _, from_, _, to_ = move.strip().split()
|
||||||
|
|
||||||
for move in moves_s:
|
for _i in range(int(count_s)):
|
||||||
_, count_s, _, from_, _, to_ = move.strip().split()
|
blocks_1[to_].append(blocks_1[from_].pop())
|
||||||
count = int(count_s)
|
|
||||||
|
|
||||||
blocks_2[to_].extend(blocks_2[from_][-count:])
|
# part 2
|
||||||
del blocks_2[from_][-count:]
|
blocks_2 = copy.deepcopy(blocks)
|
||||||
|
|
||||||
answer_1 = "".join(s[-1] for s in blocks_1.values())
|
for move in moves_s:
|
||||||
print(f"answer 1 is {answer_1}")
|
_, count_s, _, from_, _, to_ = move.strip().split()
|
||||||
|
count = int(count_s)
|
||||||
|
|
||||||
answer_2 = "".join(s[-1] for s in blocks_2.values())
|
blocks_2[to_].extend(blocks_2[from_][-count:])
|
||||||
print(f"answer 2 is {answer_2}")
|
del blocks_2[from_][-count:]
|
||||||
|
|
||||||
|
yield "".join(s[-1] for s in blocks_1.values())
|
||||||
|
yield "".join(s[-1] for s in blocks_2.values())
|
||||||
|
|||||||
@@ -1,4 +1,6 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def index_of_first_n_differents(data: str, n: int) -> int:
|
def index_of_first_n_differents(data: str, n: int) -> int:
|
||||||
@@ -8,8 +10,7 @@ def index_of_first_n_differents(data: str, n: int) -> int:
|
|||||||
return -1
|
return -1
|
||||||
|
|
||||||
|
|
||||||
data = sys.stdin.read().strip()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
yield index_of_first_n_differents(input, 4)
|
||||||
print(f"answer 1 is {index_of_first_n_differents(data, 4)}")
|
yield index_of_first_n_differents(input, 14)
|
||||||
print(f"answer 2 is {index_of_first_n_differents(data, 14)}")
|
|
||||||
|
|||||||
@@ -1,80 +1,81 @@
|
|||||||
import sys
|
|
||||||
from pathlib import Path
|
from pathlib import Path
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
# we are going to use Path to create path and go up/down in the file tree since it
|
|
||||||
# implements everything we need
|
|
||||||
#
|
|
||||||
# we can use .resolve() to get normalized path, although this will add C:\ to all paths
|
|
||||||
# on Windows but that is not an issue since only the sizes matter
|
|
||||||
#
|
|
||||||
|
|
||||||
# mapping from path to list of files or directories
|
|
||||||
trees: dict[Path, list[Path]] = {}
|
|
||||||
|
|
||||||
# mapping from paths to either size (for file) or -1 for directory
|
|
||||||
sizes: dict[Path, int] = {}
|
|
||||||
|
|
||||||
# first line must be a cd otherwise we have no idea where we are
|
|
||||||
assert lines[0].startswith("$ cd")
|
|
||||||
base_path = Path(lines[0].strip("$").split()[1]).resolve()
|
|
||||||
cur_path = base_path
|
|
||||||
|
|
||||||
trees[cur_path] = []
|
|
||||||
sizes[cur_path] = -1
|
|
||||||
|
|
||||||
for line in lines[1:]:
|
|
||||||
# command
|
|
||||||
if line.startswith("$"):
|
|
||||||
parts = line.strip("$").strip().split()
|
|
||||||
command = parts[0]
|
|
||||||
|
|
||||||
if command == "cd":
|
|
||||||
cur_path = cur_path.joinpath(parts[1]).resolve()
|
|
||||||
|
|
||||||
# just initialize the lis of files if not already done
|
|
||||||
if cur_path not in trees:
|
|
||||||
trees[cur_path] = []
|
|
||||||
else:
|
|
||||||
# nothing to do here
|
|
||||||
pass
|
|
||||||
|
|
||||||
# fill the current path
|
|
||||||
else:
|
|
||||||
parts = line.split()
|
|
||||||
name: str = parts[1]
|
|
||||||
if line.startswith("dir"):
|
|
||||||
size = -1
|
|
||||||
else:
|
|
||||||
size = int(parts[0])
|
|
||||||
|
|
||||||
path = cur_path.joinpath(name)
|
|
||||||
trees[cur_path].append(path)
|
|
||||||
sizes[path] = size
|
|
||||||
|
|
||||||
|
|
||||||
def compute_size(path: Path) -> int:
|
class Solver(BaseSolver):
|
||||||
size = sizes[path]
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
if size >= 0:
|
# we are going to use Path to create path and go up/down in the file tree since it
|
||||||
return size
|
# implements everything we need
|
||||||
|
#
|
||||||
|
# we can use .resolve() to get normalized path, although this will add C:\ to all paths
|
||||||
|
# on Windows but that is not an issue since only the sizes matter
|
||||||
|
#
|
||||||
|
|
||||||
return sum(compute_size(sub) for sub in trees[path])
|
# mapping from path to list of files or directories
|
||||||
|
trees: dict[Path, list[Path]] = {}
|
||||||
|
|
||||||
|
# mapping from paths to either size (for file) or -1 for directory
|
||||||
|
sizes: dict[Path, int] = {}
|
||||||
|
|
||||||
acc_sizes = {path: compute_size(path) for path in trees}
|
# first line must be a cd otherwise we have no idea where we are
|
||||||
|
assert lines[0].startswith("$ cd")
|
||||||
|
base_path = Path(lines[0].strip("$").split()[1]).resolve()
|
||||||
|
cur_path = base_path
|
||||||
|
|
||||||
# part 1
|
trees[cur_path] = []
|
||||||
answer_1 = sum(size for size in acc_sizes.values() if size <= 100_000)
|
sizes[cur_path] = -1
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
# part 2
|
for line in lines[1:]:
|
||||||
total_space = 70_000_000
|
# command
|
||||||
update_space = 30_000_000
|
if line.startswith("$"):
|
||||||
free_space = total_space - acc_sizes[base_path]
|
parts = line.strip("$").strip().split()
|
||||||
|
command = parts[0]
|
||||||
|
|
||||||
to_free_space = update_space - free_space
|
if command == "cd":
|
||||||
|
cur_path = cur_path.joinpath(parts[1]).resolve()
|
||||||
|
|
||||||
answer_2 = min(size for size in acc_sizes.values() if size >= to_free_space)
|
# just initialize the lis of files if not already done
|
||||||
print(f"answer 2 is {answer_2}")
|
if cur_path not in trees:
|
||||||
|
trees[cur_path] = []
|
||||||
|
else:
|
||||||
|
# nothing to do here
|
||||||
|
pass
|
||||||
|
|
||||||
|
# fill the current path
|
||||||
|
else:
|
||||||
|
parts = line.split()
|
||||||
|
name: str = parts[1]
|
||||||
|
if line.startswith("dir"):
|
||||||
|
size = -1
|
||||||
|
else:
|
||||||
|
size = int(parts[0])
|
||||||
|
|
||||||
|
path = cur_path.joinpath(name)
|
||||||
|
trees[cur_path].append(path)
|
||||||
|
sizes[path] = size
|
||||||
|
|
||||||
|
def compute_size(path: Path) -> int:
|
||||||
|
size = sizes[path]
|
||||||
|
|
||||||
|
if size >= 0:
|
||||||
|
return size
|
||||||
|
|
||||||
|
return sum(compute_size(sub) for sub in trees[path])
|
||||||
|
|
||||||
|
acc_sizes = {path: compute_size(path) for path in trees}
|
||||||
|
|
||||||
|
# part 1
|
||||||
|
yield sum(size for size in acc_sizes.values() if size <= 100_000)
|
||||||
|
|
||||||
|
# part 2
|
||||||
|
total_space = 70_000_000
|
||||||
|
update_space = 30_000_000
|
||||||
|
free_space = total_space - acc_sizes[base_path]
|
||||||
|
|
||||||
|
to_free_space = update_space - free_space
|
||||||
|
|
||||||
|
yield min(size for size in acc_sizes.values() if size >= to_free_space)
|
||||||
|
|||||||
@@ -1,53 +1,54 @@
|
|||||||
import sys
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
from numpy.typing import NDArray
|
from numpy.typing import NDArray
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
from ..base import BaseSolver
|
||||||
|
|
||||||
trees = np.array([[int(x) for x in row] for row in lines])
|
|
||||||
|
|
||||||
# answer 1
|
class Solver(BaseSolver):
|
||||||
highest_trees = np.ones(trees.shape + (4,), dtype=int) * -1
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
highest_trees[1:-1, 1:-1] = [
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
[
|
|
||||||
[
|
trees = np.array([[int(x) for x in row] for row in lines])
|
||||||
trees[:i, j].max(),
|
|
||||||
trees[i + 1 :, j].max(),
|
# answer 1
|
||||||
trees[i, :j].max(),
|
highest_trees = np.ones(trees.shape + (4,), dtype=int) * -1
|
||||||
trees[i, j + 1 :].max(),
|
highest_trees[1:-1, 1:-1] = [
|
||||||
|
[
|
||||||
|
[
|
||||||
|
trees[:i, j].max(),
|
||||||
|
trees[i + 1 :, j].max(),
|
||||||
|
trees[i, :j].max(),
|
||||||
|
trees[i, j + 1 :].max(),
|
||||||
|
]
|
||||||
|
for j in range(1, trees.shape[1] - 1)
|
||||||
|
]
|
||||||
|
for i in range(1, trees.shape[0] - 1)
|
||||||
]
|
]
|
||||||
for j in range(1, trees.shape[1] - 1)
|
|
||||||
]
|
|
||||||
for i in range(1, trees.shape[0] - 1)
|
|
||||||
]
|
|
||||||
|
|
||||||
answer_1 = (highest_trees.min(axis=2) < trees).sum()
|
yield (highest_trees.min(axis=2) < trees).sum()
|
||||||
print(f"answer 1 is {answer_1}")
|
|
||||||
|
|
||||||
|
def viewing_distance(row_of_trees: NDArray[np.int_], value: int) -> int:
|
||||||
|
w = np.where(row_of_trees >= value)[0]
|
||||||
|
|
||||||
def viewing_distance(row_of_trees: NDArray[np.int_], value: int) -> int:
|
if not w.size:
|
||||||
w = np.where(row_of_trees >= value)[0]
|
return len(row_of_trees)
|
||||||
|
|
||||||
if not w.size:
|
return w[0] + 1
|
||||||
return len(row_of_trees)
|
|
||||||
|
|
||||||
return w[0] + 1
|
# answer 2
|
||||||
|
v_distances = np.zeros(trees.shape + (4,), dtype=int)
|
||||||
|
v_distances[1:-1, 1:-1, :] = [
|
||||||
# answer 2
|
[
|
||||||
v_distances = np.zeros(trees.shape + (4,), dtype=int)
|
[
|
||||||
v_distances[1:-1, 1:-1, :] = [
|
viewing_distance(trees[i - 1 :: -1, j], trees[i, j]),
|
||||||
[
|
viewing_distance(trees[i, j - 1 :: -1], trees[i, j]),
|
||||||
[
|
viewing_distance(trees[i, j + 1 :], trees[i, j]),
|
||||||
viewing_distance(trees[i - 1 :: -1, j], trees[i, j]),
|
viewing_distance(trees[i + 1 :, j], trees[i, j]),
|
||||||
viewing_distance(trees[i, j - 1 :: -1], trees[i, j]),
|
]
|
||||||
viewing_distance(trees[i, j + 1 :], trees[i, j]),
|
for j in range(1, trees.shape[1] - 1)
|
||||||
viewing_distance(trees[i + 1 :, j], trees[i, j]),
|
]
|
||||||
|
for i in range(1, trees.shape[0] - 1)
|
||||||
]
|
]
|
||||||
for j in range(1, trees.shape[1] - 1)
|
yield np.prod(v_distances, axis=2).max()
|
||||||
]
|
|
||||||
for i in range(1, trees.shape[0] - 1)
|
|
||||||
]
|
|
||||||
answer_2 = np.prod(v_distances, axis=2).max()
|
|
||||||
print(f"answer 2 is {answer_2}")
|
|
||||||
|
|||||||
@@ -1,7 +1,10 @@
|
|||||||
import sys
|
import itertools as it
|
||||||
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import numpy as np
|
import numpy as np
|
||||||
|
|
||||||
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
def move(head: tuple[int, int], command: str) -> tuple[int, int]:
|
def move(head: tuple[int, int], command: str) -> tuple[int, int]:
|
||||||
h_col, h_row = head
|
h_col, h_row = head
|
||||||
@@ -43,17 +46,14 @@ def run(commands: list[str], n_blocks: int) -> list[tuple[int, int]]:
|
|||||||
return visited
|
return visited
|
||||||
|
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
class Solver(BaseSolver):
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
lines = [line.strip() for line in input.splitlines()]
|
||||||
|
|
||||||
# flatten the commands
|
# flatten the commands
|
||||||
commands: list[str] = []
|
commands = list(
|
||||||
for line in lines:
|
it.chain(*(p[0] * int(p[1]) for line in lines if (p := line.split())))
|
||||||
d, c = line.split()
|
)
|
||||||
commands.extend(d * int(c))
|
|
||||||
|
|
||||||
|
yield len(set(run(commands, n_blocks=2)))
|
||||||
visited_1 = run(commands, n_blocks=2)
|
yield len(set(run(commands, n_blocks=10)))
|
||||||
print(f"answer 1 is {len(set(visited_1))}")
|
|
||||||
|
|
||||||
visited_2 = run(commands, n_blocks=10)
|
|
||||||
print(f"answer 2 is {len(set(visited_2))}")
|
|
||||||
|
|||||||
@@ -83,18 +83,17 @@ class Solver(BaseSolver):
|
|||||||
if (i, j) in loop_s and lines[i][j] in "|LJ":
|
if (i, j) in loop_s and lines[i][j] in "|LJ":
|
||||||
cnt += 1
|
cnt += 1
|
||||||
|
|
||||||
if self.verbose:
|
if self.files:
|
||||||
for i in range(len(lines)):
|
rows = [["." for _j in range(len(lines[0]))] for _i in range(len(lines))]
|
||||||
s = ""
|
rows[si][sj] = "\033[91mS\033[0m"
|
||||||
for j in range(len(lines[0])):
|
|
||||||
if (i, j) == (si, sj):
|
for i, j in loop:
|
||||||
s += "\033[91mS\033[0m"
|
rows[i][j] = lines[i][j]
|
||||||
elif (i, j) in loop:
|
for i, j in inside:
|
||||||
s += lines[i][j]
|
rows[i][j] = "\033[92mI\033[0m"
|
||||||
elif (i, j) in inside:
|
|
||||||
s += "\033[92mI\033[0m"
|
self.files.create(
|
||||||
else:
|
"output.txt", "\n".join("".join(row) for row in rows).encode(), True
|
||||||
s += "."
|
)
|
||||||
self.logger.info(s)
|
|
||||||
|
|
||||||
yield len(inside)
|
yield len(inside)
|
||||||
|
|||||||
@@ -84,9 +84,14 @@ class Solver(BaseSolver):
|
|||||||
|
|
||||||
beams = propagate(layout, (0, 0), "R")
|
beams = propagate(layout, (0, 0), "R")
|
||||||
|
|
||||||
if self.verbose:
|
if self.files:
|
||||||
for row in beams:
|
self.files.create(
|
||||||
self.logger.info("".join("#" if col else "." for col in row))
|
"beams.txt",
|
||||||
|
"\n".join(
|
||||||
|
"".join("#" if col else "." for col in row) for row in beams
|
||||||
|
).encode(),
|
||||||
|
True,
|
||||||
|
)
|
||||||
|
|
||||||
# part 1
|
# part 1
|
||||||
yield sum(sum(map(bool, row)) for row in beams)
|
yield sum(sum(map(bool, row)) for row in beams)
|
||||||
|
|||||||
@@ -33,10 +33,14 @@ MAPPINGS: dict[Direction, tuple[int, int, Direction]] = {
|
|||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def print_shortest_path(
|
def print_shortest_path(
|
||||||
self,
|
self,
|
||||||
|
name: str,
|
||||||
grid: list[list[int]],
|
grid: list[list[int]],
|
||||||
target: tuple[int, int],
|
target: tuple[int, int],
|
||||||
per_cell: dict[tuple[int, int], list[tuple[Label, int]]],
|
per_cell: dict[tuple[int, int], list[tuple[Label, int]]],
|
||||||
):
|
):
|
||||||
|
if not self.files:
|
||||||
|
return
|
||||||
|
|
||||||
assert len(per_cell[target]) == 1
|
assert len(per_cell[target]) == 1
|
||||||
label = per_cell[target][0][0]
|
label = per_cell[target][0][0]
|
||||||
|
|
||||||
@@ -74,8 +78,9 @@ class Solver(BaseSolver):
|
|||||||
|
|
||||||
p_grid[0][0] = f"\033[92m{grid[0][0]}\033[0m"
|
p_grid[0][0] = f"\033[92m{grid[0][0]}\033[0m"
|
||||||
|
|
||||||
for row in p_grid:
|
self.files.create(
|
||||||
self.logger.info("".join(row))
|
name, "\n".join("".join(row) for row in p_grid).encode(), True
|
||||||
|
)
|
||||||
|
|
||||||
def shortest_many_paths(self, grid: list[list[int]]) -> dict[tuple[int, int], int]:
|
def shortest_many_paths(self, grid: list[list[int]]) -> dict[tuple[int, int], int]:
|
||||||
n_rows, n_cols = len(grid), len(grid[0])
|
n_rows, n_cols = len(grid), len(grid[0])
|
||||||
@@ -129,6 +134,7 @@ class Solver(BaseSolver):
|
|||||||
|
|
||||||
def shortest_path(
|
def shortest_path(
|
||||||
self,
|
self,
|
||||||
|
name: str,
|
||||||
grid: list[list[int]],
|
grid: list[list[int]],
|
||||||
min_straight: int,
|
min_straight: int,
|
||||||
max_straight: int,
|
max_straight: int,
|
||||||
@@ -217,8 +223,7 @@ class Solver(BaseSolver):
|
|||||||
),
|
),
|
||||||
)
|
)
|
||||||
|
|
||||||
if self.verbose:
|
self.print_shortest_path(f"shortest-path_{name}.txt", grid, target, per_cell)
|
||||||
self.print_shortest_path(grid, target, per_cell)
|
|
||||||
|
|
||||||
return per_cell[target][0][1]
|
return per_cell[target][0][1]
|
||||||
|
|
||||||
@@ -227,7 +232,7 @@ class Solver(BaseSolver):
|
|||||||
estimates = self.shortest_many_paths(data)
|
estimates = self.shortest_many_paths(data)
|
||||||
|
|
||||||
# part 1
|
# part 1
|
||||||
yield self.shortest_path(data, 1, 3, lower_bounds=estimates)
|
yield self.shortest_path("answer_1", data, 1, 3, lower_bounds=estimates)
|
||||||
|
|
||||||
# part 2
|
# part 2
|
||||||
yield self.shortest_path(data, 4, 10, lower_bounds=estimates)
|
yield self.shortest_path("answer_2", data, 4, 10, lower_bounds=estimates)
|
||||||
|
|||||||
@@ -1,4 +1,3 @@
|
|||||||
import sys
|
|
||||||
from collections import defaultdict
|
from collections import defaultdict
|
||||||
from math import lcm
|
from math import lcm
|
||||||
from typing import Any, Iterator, Literal, TypeAlias
|
from typing import Any, Iterator, Literal, TypeAlias
|
||||||
@@ -67,7 +66,7 @@ class Solver(BaseSolver):
|
|||||||
def solve(self, input: str) -> Iterator[Any]:
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
self._modules = {}
|
self._modules = {}
|
||||||
|
|
||||||
lines = sys.stdin.read().splitlines()
|
lines = input.splitlines()
|
||||||
|
|
||||||
for line in lines:
|
for line in lines:
|
||||||
name, outputs_s = line.split(" -> ")
|
name, outputs_s = line.split(" -> ")
|
||||||
@@ -80,22 +79,23 @@ class Solver(BaseSolver):
|
|||||||
outputs,
|
outputs,
|
||||||
)
|
)
|
||||||
|
|
||||||
if self.outputs:
|
if self.files:
|
||||||
with open("./day20.dot", "w") as fp:
|
contents = "digraph G {\n"
|
||||||
fp.write("digraph G {\n")
|
contents += "rx [shape=circle, color=red, style=filled];\n"
|
||||||
fp.write("rx [shape=circle, color=red, style=filled];\n")
|
for name, (type, outputs) in self._modules.items():
|
||||||
for name, (type, outputs) in self._modules.items():
|
if type == "conjunction":
|
||||||
if type == "conjunction":
|
shape = "diamond"
|
||||||
shape = "diamond"
|
elif type == "flip-flop":
|
||||||
elif type == "flip-flop":
|
shape = "box"
|
||||||
shape = "box"
|
else:
|
||||||
else:
|
shape = "circle"
|
||||||
shape = "circle"
|
contents += f"{name} [shape={shape}];\n"
|
||||||
fp.write(f"{name} [shape={shape}];\n")
|
for name, (type, outputs) in self._modules.items():
|
||||||
for name, (type, outputs) in self._modules.items():
|
for output in outputs:
|
||||||
for output in outputs:
|
contents += f"{name} -> {output};\n"
|
||||||
fp.write(f"{name} -> {output};\n")
|
contents += "}\n"
|
||||||
fp.write("}\n")
|
|
||||||
|
self.files.create("day20.dot", contents.encode(), False)
|
||||||
|
|
||||||
# part 1
|
# part 1
|
||||||
flip_flop_states: dict[str, Literal["on", "off"]] = {
|
flip_flop_states: dict[str, Literal["on", "off"]] = {
|
||||||
|
|||||||
@@ -50,7 +50,7 @@ class Solver(BaseSolver):
|
|||||||
values.append(len(tiles := reachable(map, tiles, cycle)))
|
values.append(len(tiles := reachable(map, tiles, cycle)))
|
||||||
values.append(len(tiles := reachable(map, tiles, cycle)))
|
values.append(len(tiles := reachable(map, tiles, cycle)))
|
||||||
|
|
||||||
if self.verbose:
|
if self.files:
|
||||||
n_rows, n_cols = len(map), len(map[0])
|
n_rows, n_cols = len(map), len(map[0])
|
||||||
|
|
||||||
rows = [
|
rows = [
|
||||||
@@ -66,8 +66,9 @@ class Solver(BaseSolver):
|
|||||||
if (i // cycle) % 2 == (j // cycle) % 2:
|
if (i // cycle) % 2 == (j // cycle) % 2:
|
||||||
rows[i][j] = f"\033[91m{rows[i][j]}\033[0m"
|
rows[i][j] = f"\033[91m{rows[i][j]}\033[0m"
|
||||||
|
|
||||||
for row in rows:
|
self.files.create(
|
||||||
self.logger.info("".join(row))
|
"cycle.txt", "\n".join("".join(row) for row in rows).encode(), True
|
||||||
|
)
|
||||||
|
|
||||||
self.logger.info(f"values to fit: {values}")
|
self.logger.info(f"values to fit: {values}")
|
||||||
|
|
||||||
@@ -101,32 +102,31 @@ class Solver(BaseSolver):
|
|||||||
# depending on the number of cycles, either A or B will be in the center
|
# depending on the number of cycles, either A or B will be in the center
|
||||||
#
|
#
|
||||||
|
|
||||||
counts = [
|
# counts = [
|
||||||
[
|
# [
|
||||||
sum(
|
# sum(
|
||||||
(i, j) in tiles
|
# (i, j) in tiles
|
||||||
for i in range(ci * cycle, (ci + 1) * cycle)
|
# for i in range(ci * cycle, (ci + 1) * cycle)
|
||||||
for j in range(cj * cycle, (cj + 1) * cycle)
|
# for j in range(cj * cycle, (cj + 1) * cycle)
|
||||||
)
|
# )
|
||||||
for cj in range(-2, 3)
|
# for cj in range(-2, 3)
|
||||||
]
|
# ]
|
||||||
for ci in range(-2, 3)
|
# for ci in range(-2, 3)
|
||||||
]
|
# ]
|
||||||
|
|
||||||
radius = (26501365 - rhombus) // cycle - 1
|
# radius = (26501365 - rhombus) // cycle - 1
|
||||||
A = counts[2][2] if radius % 2 == 0 else counts[2][1]
|
# A = counts[2][2] if radius % 2 == 0 else counts[2][1]
|
||||||
B = counts[2][2] if radius % 2 == 1 else counts[2][1]
|
# B = counts[2][2] if radius % 2 == 1 else counts[2][1]
|
||||||
answer_2 = (
|
# answer_2 = (
|
||||||
(radius + 1) * A
|
# (radius + 1) * A
|
||||||
+ radius * B
|
# + radius * B
|
||||||
+ 2 * radius * (radius + 1) // 2 * A
|
# + 2 * radius * (radius + 1) // 2 * A
|
||||||
+ 2 * radius * (radius - 1) // 2 * B
|
# + 2 * radius * (radius - 1) // 2 * B
|
||||||
+ sum(counts[i][j] for i, j in ((0, 2), (-1, 2), (2, 0), (2, -1)))
|
# + sum(counts[i][j] for i, j in ((0, 2), (-1, 2), (2, 0), (2, -1)))
|
||||||
+ sum(counts[i][j] for i, j in ((0, 1), (0, 3), (-1, 1), (-1, 3)))
|
# + sum(counts[i][j] for i, j in ((0, 1), (0, 3), (-1, 1), (-1, 3)))
|
||||||
* (radius + 1)
|
# * (radius + 1)
|
||||||
+ sum(counts[i][j] for i, j in ((1, 1), (1, 3), (-2, 1), (-2, 3))) * radius
|
# + sum(counts[i][j] for i, j in ((1, 1), (1, 3), (-2, 1), (-2, 3))) * radius
|
||||||
)
|
# )
|
||||||
print(f"answer 2 (v1) is {answer_2}")
|
|
||||||
|
|
||||||
# version 2: fitting a polynomial
|
# version 2: fitting a polynomial
|
||||||
#
|
#
|
||||||
|
|||||||
@@ -63,6 +63,7 @@ class Solver(BaseSolver):
|
|||||||
(x, y, z), (vx, vy, vz), positions[i1], velocities[i1]
|
(x, y, z), (vx, vy, vz), positions[i1], velocities[i1]
|
||||||
):
|
):
|
||||||
equations.append(p + ti * d - pi - ti * di)
|
equations.append(p + ti * d - pi - ti * di)
|
||||||
|
print(equations)
|
||||||
|
|
||||||
r = solve(equations, [x, y, z, vx, vy, vz] + list(ts), dict=True)[0]
|
r = solve(equations, [x, y, z, vx, vy, vz] + list(ts), dict=True)[0]
|
||||||
yield r[x] + r[y] + r[z]
|
yield r[x] + r[y] + r[z]
|
||||||
|
|||||||
@@ -1,3 +1,5 @@
|
|||||||
|
# pyright: reportUnknownMemberType=false
|
||||||
|
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
import networkx as nx
|
import networkx as nx
|
||||||
|
|||||||
@@ -1,7 +1,35 @@
|
|||||||
|
import itertools as it
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
|
def process(
|
||||||
|
grid: list[list[int]], current: tuple[int, int]
|
||||||
|
) -> set[tuple[tuple[int, int], ...]]:
|
||||||
|
row, col = current
|
||||||
|
value = grid[row][col] + 1
|
||||||
|
|
||||||
|
if grid[row][col] == 9:
|
||||||
|
return {((row, col),)}
|
||||||
|
|
||||||
|
return {
|
||||||
|
((row, col),) + path
|
||||||
|
for i, j in ((row - 1, col), (row, col + 1), (row + 1, col), (row, col - 1))
|
||||||
|
if 0 <= i < len(grid) and 0 <= j < len(grid[i]) and grid[i][j] == value
|
||||||
|
for path in process(grid, (i, j))
|
||||||
|
}
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
grid = [[int(col) for col in row] for row in input.splitlines()]
|
||||||
|
|
||||||
|
paths = {
|
||||||
|
(i, j): process(grid, (i, j))
|
||||||
|
for i, j in it.product(range(len(grid)), range(len(grid[0])))
|
||||||
|
if grid[i][j] == 0
|
||||||
|
}
|
||||||
|
|
||||||
|
yield sum(len({path[-1] for path in paths[head]}) for head in paths)
|
||||||
|
yield sum(len(paths_of) for paths_of in paths.values())
|
||||||
|
|||||||
@@ -1,7 +1,36 @@
|
|||||||
|
from functools import cache
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
|
def n_digits(n: int) -> int:
|
||||||
|
c = int(n == 0)
|
||||||
|
while n > 0:
|
||||||
|
c, n = c + 1, n // 10
|
||||||
|
return c
|
||||||
|
|
||||||
|
|
||||||
|
@cache
|
||||||
|
def blink_one_stone(stone: int, round: int) -> int:
|
||||||
|
if round == 0:
|
||||||
|
return 1
|
||||||
|
|
||||||
|
if stone == 0:
|
||||||
|
return blink_one_stone(1, round - 1)
|
||||||
|
|
||||||
|
if (n := n_digits(stone)) % 2 == 0:
|
||||||
|
p = 10 ** (n // 2)
|
||||||
|
return blink_one_stone(stone // p, round - 1) + blink_one_stone(
|
||||||
|
stone % p, round - 1
|
||||||
|
)
|
||||||
|
|
||||||
|
return blink_one_stone(stone * 2024, round - 1)
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
stones = list(map(int, input.split()))
|
||||||
|
|
||||||
|
yield sum(blink_one_stone(stone, 25) for stone in stones)
|
||||||
|
yield sum(blink_one_stone(stone, 75) for stone in stones)
|
||||||
|
|||||||
@@ -1,7 +1,101 @@
|
|||||||
from typing import Any, Iterator
|
import itertools as it
|
||||||
|
from dataclasses import dataclass
|
||||||
|
from typing import Any, Iterator, TypeAlias
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
Node: TypeAlias = tuple[int, int]
|
||||||
|
Edge: TypeAlias = tuple[Node, Node]
|
||||||
|
|
||||||
|
|
||||||
|
@dataclass(frozen=True)
|
||||||
|
class Region:
|
||||||
|
value: str
|
||||||
|
cells: set[tuple[int, int]]
|
||||||
|
edges: set[Edge]
|
||||||
|
sides: list[tuple[Edge, ...]]
|
||||||
|
|
||||||
|
|
||||||
|
def extract_region(grid: list[str], cell: tuple[int, int]):
|
||||||
|
n_rows, n_cols = len(grid), len(grid[0])
|
||||||
|
row, col = cell
|
||||||
|
|
||||||
|
value = grid[row][col]
|
||||||
|
|
||||||
|
cells: set[tuple[int, int]] = set()
|
||||||
|
edges: set[Edge] = set()
|
||||||
|
sides: list[tuple[Edge, ...]] = []
|
||||||
|
|
||||||
|
queue: list[tuple[int, int]] = [(row, col)]
|
||||||
|
while queue:
|
||||||
|
row, col = queue.pop(0)
|
||||||
|
|
||||||
|
if (row, col) in cells:
|
||||||
|
continue
|
||||||
|
|
||||||
|
cells.add((row, col))
|
||||||
|
|
||||||
|
for ur, uc in (
|
||||||
|
(row - 1, col),
|
||||||
|
(row, col + 1),
|
||||||
|
(row + 1, col),
|
||||||
|
(row, col - 1),
|
||||||
|
):
|
||||||
|
if 0 <= ur < n_rows and 0 <= uc < n_cols and grid[ur][uc] == value:
|
||||||
|
queue.append((ur, uc))
|
||||||
|
continue
|
||||||
|
|
||||||
|
if ((row, col), (ur, uc)) in edges:
|
||||||
|
continue
|
||||||
|
|
||||||
|
if col == uc:
|
||||||
|
mid, max = col, n_cols
|
||||||
|
|
||||||
|
def get(v: int):
|
||||||
|
return (row, v, ur, v)
|
||||||
|
else:
|
||||||
|
mid, max = row, n_rows
|
||||||
|
|
||||||
|
def get(v: int):
|
||||||
|
return (v, col, v, uc)
|
||||||
|
|
||||||
|
side: tuple[Edge, ...] = ((((row, col), (ur, uc))),)
|
||||||
|
for rng in (range(mid - 1, -1, -1), range(mid, max)):
|
||||||
|
for r2, c2, ur2, uc2 in map(get, rng):
|
||||||
|
if grid[r2][c2] != value or (
|
||||||
|
0 <= ur2 < n_rows
|
||||||
|
and 0 <= uc2 < n_cols
|
||||||
|
and grid[r2][c2] == grid[ur2][uc2]
|
||||||
|
):
|
||||||
|
break
|
||||||
|
side += ((((r2, c2), (ur2, uc2))),)
|
||||||
|
|
||||||
|
sides.append(side)
|
||||||
|
edges = edges.union(side)
|
||||||
|
|
||||||
|
return Region(value=value, cells=cells, edges=edges, sides=sides)
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
grid = input.splitlines()
|
||||||
|
|
||||||
|
regions: list[Region] = []
|
||||||
|
to_visit: set[tuple[int, int]] = set(
|
||||||
|
it.product(range(len(grid)), range(len(grid[0])))
|
||||||
|
)
|
||||||
|
|
||||||
|
while to_visit:
|
||||||
|
region = extract_region(grid, next(iter(to_visit)))
|
||||||
|
|
||||||
|
self.logger.info(
|
||||||
|
f"region with {region.value}: "
|
||||||
|
f"{len(region.cells)} * {len(region.edges)} = {len(region.cells) * len(region.edges)}, "
|
||||||
|
f"{len(region.cells)} * {len(region.sides)} = {len(region.cells) * len(region.sides)}"
|
||||||
|
)
|
||||||
|
|
||||||
|
to_visit.difference_update(region.cells)
|
||||||
|
regions.append(region)
|
||||||
|
|
||||||
|
yield sum(len(region.cells) * len(region.edges) for region in regions)
|
||||||
|
yield sum(len(region.cells) * len(region.sides) for region in regions)
|
||||||
|
|||||||
@@ -1,7 +1,79 @@
|
|||||||
|
import math
|
||||||
|
from dataclasses import dataclass
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
import parse # pyright: ignore[reportMissingTypeStubs]
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
|
@dataclass(frozen=True)
|
||||||
|
class Machine:
|
||||||
|
prize: tuple[int, int]
|
||||||
|
button_a: tuple[int, int]
|
||||||
|
button_b: tuple[int, int]
|
||||||
|
|
||||||
|
|
||||||
|
def read_machine(block: str) -> Machine:
|
||||||
|
ba = parse.parse( # type: ignore
|
||||||
|
"""Button A: X{bax:d}, Y{bay:d}
|
||||||
|
Button B: X{bbx:d}, Y{bby:d}
|
||||||
|
Prize: X={px:d}, Y={py:d}""",
|
||||||
|
block,
|
||||||
|
)
|
||||||
|
return Machine(
|
||||||
|
prize=(ba["px"], ba["py"]), # type: ignore
|
||||||
|
button_a=(ba["bax"], ba["bay"]), # type: ignore
|
||||||
|
button_b=(ba["bbx"], ba["bby"]), # type: ignore
|
||||||
|
)
|
||||||
|
|
||||||
|
|
||||||
|
def diophantine(a: int, b: int, c: int) -> tuple[int, int]:
|
||||||
|
q, r = divmod(a, b)
|
||||||
|
if r == 0:
|
||||||
|
return (0, c // b)
|
||||||
|
else:
|
||||||
|
u, v = diophantine(b, r, c)
|
||||||
|
return (v, u - q * v)
|
||||||
|
|
||||||
|
|
||||||
|
def solve(machine: Machine) -> int:
|
||||||
|
(ax, ay), (bx, by), (px, py) = machine.button_a, machine.button_b, machine.prize
|
||||||
|
dx, dy = math.gcd(ax, bx), math.gcd(ay, by)
|
||||||
|
|
||||||
|
if px % dx != 0 or py % dy != 0:
|
||||||
|
return 0
|
||||||
|
|
||||||
|
xa, xb = diophantine(ax, bx, px)
|
||||||
|
ya, yb = diophantine(ay, by, py)
|
||||||
|
|
||||||
|
# expr (x): xa - kx * bx / dx, xb + kx * ax / dx
|
||||||
|
# expr (y): ya - ky * by / dy, yb + ky * ay / dy
|
||||||
|
|
||||||
|
num = ay * (ya - xa) + by * (yb - xb)
|
||||||
|
den = (ax * by - ay * bx) // dx
|
||||||
|
|
||||||
|
if num % den != 0:
|
||||||
|
return 0
|
||||||
|
|
||||||
|
kx = num // den
|
||||||
|
pa, pb = xa - kx * bx // dx, xb + kx * ax // dx
|
||||||
|
return 3 * pa + pb
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
machines = [read_machine(block) for block in input.split("\n\n")]
|
||||||
|
|
||||||
|
yield sum(map(solve, machines))
|
||||||
|
|
||||||
|
shift = 10000000000000
|
||||||
|
machines = [
|
||||||
|
Machine(
|
||||||
|
prize=(shift + m.prize[0], shift + m.prize[1]),
|
||||||
|
button_a=m.button_a,
|
||||||
|
button_b=m.button_b,
|
||||||
|
)
|
||||||
|
for m in machines
|
||||||
|
]
|
||||||
|
yield sum(map(solve, machines))
|
||||||
|
|||||||
@@ -1,7 +1,74 @@
|
|||||||
|
import itertools as it
|
||||||
|
import operator as op
|
||||||
|
from math import prod
|
||||||
from typing import Any, Iterator
|
from typing import Any, Iterator
|
||||||
|
|
||||||
|
import numpy as np
|
||||||
|
import parse # pyright: ignore[reportMissingTypeStubs]
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
positions: list[tuple[int, int]] = []
|
||||||
|
velocities: list[tuple[int, int]] = []
|
||||||
|
|
||||||
|
for line in input.splitlines():
|
||||||
|
r = parse.parse("p={x:d},{y:d} v={vx:d},{vy:d}", line) # type: ignore
|
||||||
|
positions.append((r["y"], r["x"])) # type: ignore
|
||||||
|
velocities.append((r["vy"], r["vx"])) # type: ignore
|
||||||
|
|
||||||
|
n_rows, n_cols = 103, 101
|
||||||
|
if len(positions) < 20:
|
||||||
|
n_rows, n_cols = 7, 11
|
||||||
|
|
||||||
|
n_rounds = 100
|
||||||
|
new_positions = [
|
||||||
|
((row + v_row * n_rounds) % n_rows, (col + v_col * n_rounds) % n_cols)
|
||||||
|
for (row, col), (v_row, v_col) in zip(positions, velocities, strict=True)
|
||||||
|
]
|
||||||
|
|
||||||
|
midrow = n_rows // 2
|
||||||
|
midcol = n_cols // 2
|
||||||
|
|
||||||
|
yield prod(
|
||||||
|
(
|
||||||
|
sum(opr(row, midrow) and opc(col, midcol) for row, col in new_positions)
|
||||||
|
for opr, opc in it.product((op.gt, op.lt), repeat=2)
|
||||||
|
)
|
||||||
|
)
|
||||||
|
|
||||||
|
new_positions = positions.copy()
|
||||||
|
for rnd in self.progress.wrap(range(10000)):
|
||||||
|
new_positions = [
|
||||||
|
((row + v_row) % n_rows, (col + v_col) % n_cols)
|
||||||
|
for (row, col), (v_row, v_col) in zip(
|
||||||
|
new_positions, velocities, strict=True
|
||||||
|
)
|
||||||
|
]
|
||||||
|
m = [[False for _ in range(n_cols)] for _ in range(n_rows)]
|
||||||
|
for row, col in new_positions:
|
||||||
|
m[row][col] = True
|
||||||
|
|
||||||
|
found = False
|
||||||
|
for row in m:
|
||||||
|
if sum(row) <= 10:
|
||||||
|
continue
|
||||||
|
if any(all(row[i : i + 10]) for i in range(n_cols - 10)):
|
||||||
|
if self.files:
|
||||||
|
self.files.create(
|
||||||
|
f"result_{rnd+1}.txt",
|
||||||
|
"\n".join(
|
||||||
|
"".join("#" if m[i][j] else "." for j in range(n_cols))
|
||||||
|
for i in range(n_rows)
|
||||||
|
).encode(),
|
||||||
|
True,
|
||||||
|
)
|
||||||
|
self.files.image(f"result_{rnd+1}.png", np.array(m))
|
||||||
|
yield rnd + 1
|
||||||
|
# found = True
|
||||||
|
break
|
||||||
|
|
||||||
|
if found:
|
||||||
|
break
|
||||||
|
|||||||
@@ -1,7 +1,282 @@
|
|||||||
from typing import Any, Iterator
|
from typing import Any, Callable, Final, Iterator, TypeAlias
|
||||||
|
|
||||||
|
import numpy as np
|
||||||
|
from numpy.typing import NDArray
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
ImageGrid: TypeAlias = NDArray[np.uint8]
|
||||||
|
|
||||||
|
|
||||||
|
class Grid:
|
||||||
|
FREE: Final = 0
|
||||||
|
BLOCK: Final = 1
|
||||||
|
ROBOT: Final = 2
|
||||||
|
|
||||||
|
robot: tuple[int, int]
|
||||||
|
|
||||||
|
def __init__(self, grid_s: list[str], large: bool):
|
||||||
|
grid: list[list[int]] = []
|
||||||
|
robot: tuple[int, int] | None = None
|
||||||
|
box_counter = 4 if not large else 5
|
||||||
|
for i_row, row in enumerate(grid_s):
|
||||||
|
row_u: list[int] = []
|
||||||
|
for i_col, col in enumerate(row):
|
||||||
|
if col in ".@":
|
||||||
|
row_u.extend((Grid.FREE, Grid.FREE) if large else (Grid.FREE,))
|
||||||
|
if col == "@":
|
||||||
|
robot = (i_row, i_col * 2 if large else i_col)
|
||||||
|
elif col == "#":
|
||||||
|
row_u.extend((Grid.BLOCK, Grid.BLOCK) if large else (Grid.BLOCK,))
|
||||||
|
else:
|
||||||
|
row_u.extend(
|
||||||
|
(box_counter, -box_counter) if large else (box_counter,)
|
||||||
|
)
|
||||||
|
box_counter += 2
|
||||||
|
grid.append(row_u)
|
||||||
|
|
||||||
|
self.grid = np.array(grid)
|
||||||
|
|
||||||
|
assert robot is not None
|
||||||
|
self.robot = robot
|
||||||
|
|
||||||
|
@property
|
||||||
|
def n_rows(self):
|
||||||
|
return len(self.grid)
|
||||||
|
|
||||||
|
@property
|
||||||
|
def n_columns(self):
|
||||||
|
return len(self.grid[0])
|
||||||
|
|
||||||
|
def __len__(self):
|
||||||
|
return self.n_rows
|
||||||
|
|
||||||
|
def __iter__(self):
|
||||||
|
return iter(self.grid)
|
||||||
|
|
||||||
|
def __getitem__(self, index: tuple[int, int]):
|
||||||
|
return self.grid[*index]
|
||||||
|
|
||||||
|
def __setitem__(self, index: tuple[int, int], value: int):
|
||||||
|
self.grid[*index] = value
|
||||||
|
|
||||||
|
def is_free(self, row: int, col: int):
|
||||||
|
return self[row, col] == Grid.FREE
|
||||||
|
|
||||||
|
def is_block(self, row: int, col: int):
|
||||||
|
return self[row, col] == Grid.BLOCK
|
||||||
|
|
||||||
|
def is_box(self, row: int, col: int):
|
||||||
|
return (c := self[row, col]) >= 4 and c % 2 == 0
|
||||||
|
|
||||||
|
def is_open_or_close_box(self, row: int, col: int):
|
||||||
|
return abs(c := self[row, col]) >= 4 and c % 2 == 1
|
||||||
|
|
||||||
|
def is_open_box(self, row: int, col: int):
|
||||||
|
return (c := self[row, col]) >= 4 and c % 2 == 1
|
||||||
|
|
||||||
|
def is_close_box(self, row: int, col: int):
|
||||||
|
return self[row, col] < 0
|
||||||
|
|
||||||
|
def _to_char(self, row: int, col: int):
|
||||||
|
if self.is_free(row, col):
|
||||||
|
return "."
|
||||||
|
elif self.is_block(row, col):
|
||||||
|
return "#"
|
||||||
|
elif self.is_box(row, col):
|
||||||
|
return "O"
|
||||||
|
elif self.is_open_box(row, col):
|
||||||
|
return "["
|
||||||
|
else:
|
||||||
|
return "]"
|
||||||
|
|
||||||
|
def as_numpy(self):
|
||||||
|
arr = self.grid.copy()
|
||||||
|
arr[*self.robot] = Grid.ROBOT
|
||||||
|
return arr
|
||||||
|
|
||||||
|
def as_printable(self):
|
||||||
|
grid_s = [
|
||||||
|
[self._to_char(row, col) for col in range(self.n_columns)]
|
||||||
|
for row in range(self.n_rows)
|
||||||
|
]
|
||||||
|
grid_s[self.robot[0]][self.robot[1]] = "\033[31;1m@\033[00m"
|
||||||
|
return "\n".join("".join(row) for row in grid_s)
|
||||||
|
|
||||||
|
def __str__(self):
|
||||||
|
return self.as_printable()
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def save_grid(self, name: str, grid: Grid):
|
||||||
|
if self.files:
|
||||||
|
self.files.create(name, grid.as_printable().encode(), True)
|
||||||
|
|
||||||
|
def step_part1(self, grid: Grid, move: str):
|
||||||
|
match move:
|
||||||
|
case "^":
|
||||||
|
d_row, d_col = -1, 0
|
||||||
|
case ">":
|
||||||
|
d_row, d_col = 0, 1
|
||||||
|
case "v":
|
||||||
|
d_row, d_col = 1, 0
|
||||||
|
case "<":
|
||||||
|
d_row, d_col = 0, -1
|
||||||
|
case _:
|
||||||
|
assert False
|
||||||
|
|
||||||
|
row, col = grid.robot
|
||||||
|
if grid.is_free(row + d_row, col + d_col):
|
||||||
|
grid.robot = (row + d_row, col + d_col)
|
||||||
|
elif not grid.is_block(row + d_row, col + d_col):
|
||||||
|
n = 1
|
||||||
|
while grid.is_box(row + n * d_row, col + n * d_col):
|
||||||
|
n += 1
|
||||||
|
|
||||||
|
if grid.is_free(row + n * d_row, col + n * d_col):
|
||||||
|
grid.robot = (row + d_row, col + d_col)
|
||||||
|
for k in range(2, n + 1):
|
||||||
|
grid[row + k * d_row, col + k * d_col] = grid[
|
||||||
|
row + (k - 1) * d_row, col + (k - 1) * d_col
|
||||||
|
]
|
||||||
|
grid[row + d_row, col + d_col] = Grid.FREE
|
||||||
|
|
||||||
|
return grid
|
||||||
|
|
||||||
|
def step_part2(self, grid: Grid, move: str):
|
||||||
|
match move:
|
||||||
|
case "^":
|
||||||
|
d_row, d_col = -1, 0
|
||||||
|
case ">":
|
||||||
|
d_row, d_col = 0, 1
|
||||||
|
case "v":
|
||||||
|
d_row, d_col = 1, 0
|
||||||
|
case "<":
|
||||||
|
d_row, d_col = 0, -1
|
||||||
|
case _:
|
||||||
|
assert False
|
||||||
|
|
||||||
|
row, col = grid.robot
|
||||||
|
if grid.is_free(row + d_row, col + d_col):
|
||||||
|
grid.robot = (row + d_row, col + d_col)
|
||||||
|
elif grid.is_block(row + d_row, col + d_col):
|
||||||
|
...
|
||||||
|
elif move in "<>":
|
||||||
|
n = 1
|
||||||
|
while grid.is_open_or_close_box(row, col + n * d_col):
|
||||||
|
n += 1
|
||||||
|
|
||||||
|
if grid.is_free(row, col + n * d_col):
|
||||||
|
grid.robot = (row, col + d_col)
|
||||||
|
for k in range(n, 1, -1):
|
||||||
|
grid[row, col + k * d_col] = grid[row, col + (k - 1) * d_col]
|
||||||
|
grid[row + d_row, col + d_col] = Grid.FREE
|
||||||
|
|
||||||
|
elif move in "^v":
|
||||||
|
n = 1
|
||||||
|
boxes: list[set[int]] = [{col}]
|
||||||
|
while True:
|
||||||
|
to_move = boxes[-1]
|
||||||
|
if any(grid.is_block(row + n * d_row, c) for c in to_move):
|
||||||
|
break
|
||||||
|
if all(grid.is_free(row + n * d_row, c) for c in to_move):
|
||||||
|
break
|
||||||
|
|
||||||
|
as_move: set[int] = set()
|
||||||
|
|
||||||
|
for c in to_move:
|
||||||
|
if grid.is_close_box(row + n * d_row, c):
|
||||||
|
as_move.update({c - 1, c})
|
||||||
|
elif grid.is_open_box(row + n * d_row, c):
|
||||||
|
as_move.update({c, c + 1})
|
||||||
|
|
||||||
|
boxes.append(as_move)
|
||||||
|
n += 1
|
||||||
|
|
||||||
|
if all(grid.is_free(row + n * d_row, c) for c in boxes[-1]):
|
||||||
|
for k, to_move in zip(range(n, 1, -1), boxes[-1:0:-1], strict=True):
|
||||||
|
for c in to_move:
|
||||||
|
grid[row + k * d_row, c] = grid[row + (k - 1) * d_row, c]
|
||||||
|
grid[row + (k - 1) * d_row, c] = Grid.FREE
|
||||||
|
grid.robot = (row + d_row, col + d_col)
|
||||||
|
|
||||||
|
return grid
|
||||||
|
|
||||||
|
def run(
|
||||||
|
self,
|
||||||
|
name: str,
|
||||||
|
grid: Grid,
|
||||||
|
moves: str,
|
||||||
|
fn: Callable[[Grid, str], Grid],
|
||||||
|
generate: bool,
|
||||||
|
) -> tuple[Grid, list[ImageGrid]]:
|
||||||
|
# initialize
|
||||||
|
images: list[ImageGrid] = []
|
||||||
|
|
||||||
|
if generate:
|
||||||
|
images.append(grid.as_numpy())
|
||||||
|
|
||||||
|
self.save_grid(f"initial_grid_{name}.txt", grid)
|
||||||
|
|
||||||
|
for move in self.progress.wrap(moves):
|
||||||
|
self.logger.debug(f"Move '{move}'...")
|
||||||
|
grid = fn(grid, move)
|
||||||
|
|
||||||
|
if generate:
|
||||||
|
images.append(grid.as_numpy())
|
||||||
|
|
||||||
|
self.save_grid(f"final_grid_{name}.txt", grid)
|
||||||
|
|
||||||
|
return grid, images
|
||||||
|
|
||||||
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
grid_s, moves = input.split("\n\n")
|
||||||
|
moves = "".join(moves.split())
|
||||||
|
|
||||||
|
n_boxes = grid_s.count("O")
|
||||||
|
colors = np.concatenate(
|
||||||
|
[
|
||||||
|
np.array(
|
||||||
|
[[255, 255, 255], [64, 64, 64], [255, 0, 0]],
|
||||||
|
dtype=np.uint8,
|
||||||
|
),
|
||||||
|
np.random.randint(0, 256, size=(n_boxes, 3), dtype=np.uint8),
|
||||||
|
],
|
||||||
|
dtype=np.uint8,
|
||||||
|
)
|
||||||
|
|
||||||
|
grid, images = self.run(
|
||||||
|
"part1",
|
||||||
|
Grid(grid_s.splitlines(), False),
|
||||||
|
moves,
|
||||||
|
self.step_part1,
|
||||||
|
self.files is not None,
|
||||||
|
)
|
||||||
|
if self.files:
|
||||||
|
images = np.stack(images, axis=0)
|
||||||
|
images[images >= 2] = 1 + images[images >= 2] // 2
|
||||||
|
self.files.video("anim_part1.webm", colors[images])
|
||||||
|
yield sum(
|
||||||
|
100 * row + col
|
||||||
|
for row in range(grid.n_rows)
|
||||||
|
for col in range(grid.n_columns)
|
||||||
|
if grid.is_box(row, col)
|
||||||
|
)
|
||||||
|
|
||||||
|
grid, images = self.run(
|
||||||
|
"part2",
|
||||||
|
Grid(grid_s.splitlines(), True),
|
||||||
|
moves,
|
||||||
|
self.step_part2,
|
||||||
|
self.files is not None,
|
||||||
|
)
|
||||||
|
if self.files:
|
||||||
|
images = np.abs(np.stack(images, axis=0))
|
||||||
|
images[images >= 2] = 1 + images[images >= 2] // 2
|
||||||
|
self.files.video("anim_part2.webm", colors[images])
|
||||||
|
yield sum(
|
||||||
|
100 * row + col
|
||||||
|
for row in range(grid.n_rows)
|
||||||
|
for col in range(grid.n_columns)
|
||||||
|
if grid.is_open_box(row, col)
|
||||||
|
)
|
||||||
|
|||||||
@@ -1,7 +1,62 @@
|
|||||||
from typing import Any, Iterator
|
import heapq
|
||||||
|
from collections import defaultdict
|
||||||
|
from typing import Any, Iterator, TypeAlias
|
||||||
|
|
||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
Position: TypeAlias = tuple[int, int]
|
||||||
|
Direction: TypeAlias = tuple[int, int]
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
grid = [list(r) for r in input.splitlines()]
|
||||||
|
n_rows, n_cols = len(grid), len(grid[0])
|
||||||
|
rein = next(
|
||||||
|
(i, j) for i in range(n_rows) for j in range(n_cols) if grid[i][j] == "S"
|
||||||
|
)
|
||||||
|
target = next(
|
||||||
|
(i, j) for i in range(n_rows) for j in range(n_cols) if grid[i][j] == "E"
|
||||||
|
)
|
||||||
|
|
||||||
|
queue: list[tuple[int, Position, Direction, tuple[Position, ...]]] = [
|
||||||
|
(0, rein, (0, 1), (rein,))
|
||||||
|
]
|
||||||
|
|
||||||
|
max_score = n_rows * n_cols * 1000
|
||||||
|
target_score: int = max_score
|
||||||
|
scores: dict[tuple[Position, Direction], int] = defaultdict(lambda: max_score)
|
||||||
|
visited: set[Position] = set()
|
||||||
|
|
||||||
|
while queue:
|
||||||
|
score, pos, dir, path = heapq.heappop(queue)
|
||||||
|
|
||||||
|
if target_score < score:
|
||||||
|
break
|
||||||
|
|
||||||
|
if pos == target:
|
||||||
|
target_score = score
|
||||||
|
visited |= set(path)
|
||||||
|
continue
|
||||||
|
|
||||||
|
scores[pos, dir] = score
|
||||||
|
|
||||||
|
row, col = pos
|
||||||
|
d_row, d_col = dir
|
||||||
|
|
||||||
|
for cost, n_pos, n_dir in (
|
||||||
|
(1, (row + d_row, col + d_col), dir),
|
||||||
|
(1000, pos, (1, 0) if d_row == 0 else (0, 1)),
|
||||||
|
(1000, pos, (-1, 0) if d_row == 0 else (0, -1)),
|
||||||
|
):
|
||||||
|
n_row, n_col = n_pos
|
||||||
|
score_n = score + cost
|
||||||
|
if grid[n_row][n_col] != "#" and score_n < scores[n_pos, n_dir]:
|
||||||
|
heapq.heappush(
|
||||||
|
queue,
|
||||||
|
(score_n, n_pos, n_dir, path + (n_pos,)),
|
||||||
|
)
|
||||||
|
|
||||||
|
assert target_score is not None
|
||||||
|
yield target_score
|
||||||
|
yield len(visited)
|
||||||
|
|||||||
@@ -3,5 +3,128 @@ from typing import Any, Iterator
|
|||||||
from ..base import BaseSolver
|
from ..base import BaseSolver
|
||||||
|
|
||||||
|
|
||||||
|
def combo(registers: dict[str, int], operand: int):
|
||||||
|
if operand < 4:
|
||||||
|
return operand
|
||||||
|
assert operand < 7
|
||||||
|
return registers["ABC"[operand - 4]]
|
||||||
|
|
||||||
|
|
||||||
|
def adv(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["A"] = registers["A"] >> combo(registers, operand)
|
||||||
|
|
||||||
|
|
||||||
|
def bxl(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["B"] ^= operand
|
||||||
|
|
||||||
|
|
||||||
|
def bst(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["B"] = combo(registers, operand) % 8
|
||||||
|
|
||||||
|
|
||||||
|
def jnz(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
if registers["A"] != 0:
|
||||||
|
return operand
|
||||||
|
|
||||||
|
|
||||||
|
def bxc(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["B"] = registers["B"] ^ registers["C"]
|
||||||
|
|
||||||
|
|
||||||
|
def bdv(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["B"] = registers["A"] >> combo(registers, operand)
|
||||||
|
|
||||||
|
|
||||||
|
def cdv(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
registers["C"] = registers["A"] >> combo(registers, operand)
|
||||||
|
|
||||||
|
|
||||||
|
def run(registers: dict[str, int], program: list[int]):
|
||||||
|
outputs: list[int] = []
|
||||||
|
|
||||||
|
def out(registers: dict[str, int], operand: int) -> int | None:
|
||||||
|
outputs.append(combo(registers, operand) % 8)
|
||||||
|
|
||||||
|
instructions = [adv, bxl, bst, jnz, bxc, out, bdv, cdv]
|
||||||
|
|
||||||
|
index = 0
|
||||||
|
while index < len(program):
|
||||||
|
instruction, operand = instructions[program[index]], program[index + 1]
|
||||||
|
|
||||||
|
ret = instruction(registers, operand)
|
||||||
|
|
||||||
|
if ret is None:
|
||||||
|
index += 2
|
||||||
|
else:
|
||||||
|
index = ret
|
||||||
|
|
||||||
|
return outputs
|
||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
register_s, program_s = input.split("\n\n")
|
||||||
|
|
||||||
|
registers = {
|
||||||
|
p[0][-1]: int(p[1].strip())
|
||||||
|
for line in register_s.splitlines()
|
||||||
|
if (p := line.split(":"))
|
||||||
|
}
|
||||||
|
program = [int(c) for c in program_s.split(":")[1].strip().split(",")]
|
||||||
|
|
||||||
|
self.logger.info(f"program ({len(program)}): " + ",".join(map(str, program)))
|
||||||
|
|
||||||
|
instruction_s = [
|
||||||
|
"A = A >> {}",
|
||||||
|
"B = B ^ {}",
|
||||||
|
"B = {} % 8",
|
||||||
|
"JMP {}",
|
||||||
|
"B = B ^ C",
|
||||||
|
"OUT {} % 8",
|
||||||
|
"B = A >> {}",
|
||||||
|
"C = A >> {}",
|
||||||
|
]
|
||||||
|
|
||||||
|
self.logger.info("PROGRAM:")
|
||||||
|
for index in range(0, len(program), 2):
|
||||||
|
self.logger.info(
|
||||||
|
instruction_s[program[index]].format(
|
||||||
|
""
|
||||||
|
if program[index] == 4
|
||||||
|
else (
|
||||||
|
program[index + 1]
|
||||||
|
if program[index] in (1, 3) or program[index + 1] < 4
|
||||||
|
else "ABC"[program[index + 1] - 4]
|
||||||
|
)
|
||||||
|
),
|
||||||
|
)
|
||||||
|
|
||||||
|
yield ",".join(map(str, run(registers.copy(), program)))
|
||||||
|
|
||||||
|
# last instruction is JNZ 0 (jump at the beginning), and it is the only jump
|
||||||
|
# in the program
|
||||||
|
jnz_indices = [i for i in range(0, len(program), 2) if program[i] == 3]
|
||||||
|
assert jnz_indices == [len(program) - 2] and program[-1] == 0
|
||||||
|
|
||||||
|
# previous instruction is dividing A by 8, or A = A >> 3
|
||||||
|
assert program[-4:-2] == [0, 3]
|
||||||
|
|
||||||
|
# previous instruction is a OUT B % 8, and it is the only OUT in the program
|
||||||
|
out_indices = [i for i in range(0, len(program), 2) if program[i] == 5]
|
||||||
|
assert out_indices == [len(program) - 6] and program[len(program) - 5] == 5
|
||||||
|
|
||||||
|
valid: list[int] = [0]
|
||||||
|
for p in reversed(program):
|
||||||
|
new_valid: list[int] = []
|
||||||
|
for v in valid:
|
||||||
|
a_high = v << 3
|
||||||
|
for a_low in range(0, 2**3):
|
||||||
|
registers["A"] = a_high | a_low
|
||||||
|
run(registers, program[:-6])
|
||||||
|
if registers["B"] % 8 == p:
|
||||||
|
new_valid.append(a_high | a_low)
|
||||||
|
valid = new_valid
|
||||||
|
|
||||||
|
assert run(registers | {"A": min(valid)}, program) == program
|
||||||
|
|
||||||
|
yield min(valid)
|
||||||
|
|||||||
@@ -4,4 +4,64 @@ from ..base import BaseSolver
|
|||||||
|
|
||||||
|
|
||||||
class Solver(BaseSolver):
|
class Solver(BaseSolver):
|
||||||
def solve(self, input: str) -> Iterator[Any]: ...
|
def solve(self, input: str) -> Iterator[Any]:
|
||||||
|
blocks: list[tuple[int, int]] = []
|
||||||
|
frees: list[tuple[int, int]] = []
|
||||||
|
|
||||||
|
contents_0: list[int | None] = [None for _ in range(sum(map(int, input)))]
|
||||||
|
|
||||||
|
acc = 0
|
||||||
|
for i, c in enumerate(input):
|
||||||
|
if i % 2 == 0:
|
||||||
|
for j in range(acc, acc + int(c)):
|
||||||
|
contents_0[j] = i // 2
|
||||||
|
blocks.append((acc, int(c)))
|
||||||
|
else:
|
||||||
|
frees.append((acc, int(c)))
|
||||||
|
acc += int(c)
|
||||||
|
|
||||||
|
assert contents_0[-1] is not None
|
||||||
|
|
||||||
|
contents = contents_0.copy()
|
||||||
|
|
||||||
|
free_0 = next(i for i, c in enumerate(contents) if c is None)
|
||||||
|
next_b = len(contents) - 1
|
||||||
|
|
||||||
|
while free_0 < next_b:
|
||||||
|
contents[free_0], contents[next_b] = contents[next_b], contents[free_0]
|
||||||
|
|
||||||
|
free_0 += 1
|
||||||
|
while free_0 < len(contents) and contents[free_0] is not None:
|
||||||
|
free_0 += 1
|
||||||
|
|
||||||
|
next_b -= 1
|
||||||
|
while next_b >= 0 and contents[next_b] is None:
|
||||||
|
next_b -= 1
|
||||||
|
|
||||||
|
yield sum(i * c for i, c in enumerate(contents) if c is not None)
|
||||||
|
|
||||||
|
contents = contents_0.copy()
|
||||||
|
|
||||||
|
for block_start, block_length in self.progress.wrap(blocks[::-1]):
|
||||||
|
try:
|
||||||
|
i_free = next(
|
||||||
|
i_free
|
||||||
|
for i_free, (free_start, free_length) in enumerate(frees)
|
||||||
|
if free_start < block_start and free_length >= block_length
|
||||||
|
)
|
||||||
|
except StopIteration:
|
||||||
|
continue
|
||||||
|
|
||||||
|
free_start, free_length = frees[i_free]
|
||||||
|
|
||||||
|
contents[free_start : free_start + block_length] = contents[
|
||||||
|
block_start : block_start + block_length
|
||||||
|
]
|
||||||
|
contents[block_start : block_start + block_length] = [None] * block_length
|
||||||
|
|
||||||
|
if free_length == block_length:
|
||||||
|
del frees[i_free]
|
||||||
|
else:
|
||||||
|
frees[i_free] = (free_start + block_length, free_length - block_length)
|
||||||
|
|
||||||
|
yield sum(i * c for i, c in enumerate(contents) if c is not None)
|
||||||
|
|||||||
@@ -1,107 +1,15 @@
|
|||||||
import argparse
|
import argparse
|
||||||
import importlib
|
import importlib
|
||||||
import json
|
|
||||||
import logging
|
import logging
|
||||||
import logging.handlers
|
import logging.handlers
|
||||||
import sys
|
import sys
|
||||||
from datetime import datetime, timedelta
|
from datetime import datetime
|
||||||
from pathlib import Path
|
from pathlib import Path
|
||||||
from typing import Any, Iterable, Iterator, Literal, Sequence, TextIO, TypeVar
|
|
||||||
|
|
||||||
from tqdm import tqdm
|
|
||||||
|
|
||||||
from .base import BaseSolver
|
from .base import BaseSolver
|
||||||
|
from .utils.api import FileHandlerAPI, LoggerAPIHandler, ProgressAPI, dump_answer
|
||||||
_T = TypeVar("_T")
|
from .utils.files import SimpleFileHandler
|
||||||
|
from .utils.progress import ProgressNone, ProgressTQDM
|
||||||
|
|
||||||
def dump_api_message(
|
|
||||||
type: Literal["log", "answer", "progress-start", "progress-step", "progress-end"],
|
|
||||||
content: Any,
|
|
||||||
file: TextIO = sys.stdout,
|
|
||||||
):
|
|
||||||
print(
|
|
||||||
json.dumps(
|
|
||||||
{"type": type, "time": datetime.now().isoformat(), "content": content}
|
|
||||||
),
|
|
||||||
flush=True,
|
|
||||||
file=file,
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
class LoggerAPIHandler(logging.Handler):
|
|
||||||
def __init__(self, output: TextIO = sys.stdout):
|
|
||||||
super().__init__()
|
|
||||||
self.output = output
|
|
||||||
|
|
||||||
def emit(self, record: logging.LogRecord):
|
|
||||||
dump_api_message(
|
|
||||||
"log", {"level": record.levelname, "message": record.getMessage()}
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
class ProgressAPI:
|
|
||||||
def __init__(
|
|
||||||
self,
|
|
||||||
min_step: int = 1,
|
|
||||||
min_time: timedelta = timedelta(milliseconds=100),
|
|
||||||
output: TextIO = sys.stdout,
|
|
||||||
):
|
|
||||||
super().__init__()
|
|
||||||
|
|
||||||
self.counter = 0
|
|
||||||
self.output = output
|
|
||||||
self.min_step = min_step
|
|
||||||
self.min_time = min_time
|
|
||||||
|
|
||||||
def wrap(
|
|
||||||
self, values: Sequence[_T] | Iterable[_T], total: int | None = None
|
|
||||||
) -> Iterator[_T]:
|
|
||||||
total = total or len(values) # type: ignore
|
|
||||||
|
|
||||||
current = self.counter
|
|
||||||
self.counter += 1
|
|
||||||
|
|
||||||
dump_api_message("progress-start", {"counter": current, "total": total})
|
|
||||||
|
|
||||||
try:
|
|
||||||
percent = 0
|
|
||||||
time = datetime.now()
|
|
||||||
|
|
||||||
for i_value, value in enumerate(values):
|
|
||||||
yield value
|
|
||||||
|
|
||||||
if datetime.now() - time < self.min_time:
|
|
||||||
continue
|
|
||||||
|
|
||||||
time = datetime.now()
|
|
||||||
|
|
||||||
c_percent = round(i_value / total * 100)
|
|
||||||
|
|
||||||
if c_percent >= percent + self.min_step:
|
|
||||||
dump_api_message(
|
|
||||||
"progress-step", {"counter": current, "percent": c_percent}
|
|
||||||
)
|
|
||||||
percent = c_percent
|
|
||||||
finally:
|
|
||||||
dump_api_message(
|
|
||||||
"progress-end",
|
|
||||||
{"counter": current},
|
|
||||||
)
|
|
||||||
|
|
||||||
|
|
||||||
class ProgressTQDM:
|
|
||||||
def wrap(
|
|
||||||
self, values: Sequence[_T] | Iterable[_T], total: int | None = None
|
|
||||||
) -> Iterator[_T]:
|
|
||||||
return iter(tqdm(values, total=total))
|
|
||||||
|
|
||||||
|
|
||||||
class ProgressNone:
|
|
||||||
def wrap(
|
|
||||||
self, values: Sequence[_T] | Iterable[_T], total: int | None = None
|
|
||||||
) -> Iterator[_T]:
|
|
||||||
return iter(values)
|
|
||||||
|
|
||||||
|
|
||||||
def main():
|
def main():
|
||||||
@@ -109,6 +17,13 @@ def main():
|
|||||||
parser.add_argument("-v", "--verbose", action="store_true", help="verbose mode")
|
parser.add_argument("-v", "--verbose", action="store_true", help="verbose mode")
|
||||||
parser.add_argument("-t", "--test", action="store_true", help="test mode")
|
parser.add_argument("-t", "--test", action="store_true", help="test mode")
|
||||||
parser.add_argument("-a", "--api", action="store_true", help="API mode")
|
parser.add_argument("-a", "--api", action="store_true", help="API mode")
|
||||||
|
parser.add_argument(
|
||||||
|
"-o",
|
||||||
|
"--output",
|
||||||
|
type=Path,
|
||||||
|
default=Path("files"),
|
||||||
|
help="output folder for created files",
|
||||||
|
)
|
||||||
parser.add_argument(
|
parser.add_argument(
|
||||||
"-u", "--user", type=str, default="holt59", help="user input to use"
|
"-u", "--user", type=str, default="holt59", help="user input to use"
|
||||||
)
|
)
|
||||||
@@ -135,14 +50,14 @@ def main():
|
|||||||
test: bool = args.test
|
test: bool = args.test
|
||||||
stdin: bool = args.stdin
|
stdin: bool = args.stdin
|
||||||
user: str = args.user
|
user: str = args.user
|
||||||
|
files_output: Path = args.output
|
||||||
input_path: Path | None = args.input
|
input_path: Path | None = args.input
|
||||||
|
|
||||||
year: int = args.year
|
year: int = args.year
|
||||||
day: int = args.day
|
day: int = args.day
|
||||||
|
|
||||||
# TODO: change this
|
|
||||||
logging.basicConfig(
|
logging.basicConfig(
|
||||||
level=logging.INFO if verbose or api else logging.WARNING,
|
level=logging.INFO if verbose else logging.WARNING,
|
||||||
handlers=[LoggerAPIHandler()] if api else None,
|
handlers=[LoggerAPIHandler()] if api else None,
|
||||||
)
|
)
|
||||||
|
|
||||||
@@ -166,7 +81,11 @@ def main():
|
|||||||
else ProgressTQDM()
|
else ProgressTQDM()
|
||||||
if verbose
|
if verbose
|
||||||
else ProgressNone(), # type: ignore
|
else ProgressNone(), # type: ignore
|
||||||
outputs=not api,
|
files=FileHandlerAPI(files_output)
|
||||||
|
if api and verbose
|
||||||
|
else SimpleFileHandler(logging.getLogger("AOC"), files_output)
|
||||||
|
if verbose
|
||||||
|
else None,
|
||||||
)
|
)
|
||||||
|
|
||||||
data: str
|
data: str
|
||||||
@@ -179,7 +98,7 @@ def main():
|
|||||||
start = datetime.now()
|
start = datetime.now()
|
||||||
last = start
|
last = start
|
||||||
|
|
||||||
it = solver.solve(data.strip())
|
it = solver.solve(data.rstrip())
|
||||||
|
|
||||||
if it is None:
|
if it is None:
|
||||||
solver.logger.error(f"no implementation for {year} day {day}")
|
solver.logger.error(f"no implementation for {year} day {day}")
|
||||||
@@ -189,14 +108,11 @@ def main():
|
|||||||
current = datetime.now()
|
current = datetime.now()
|
||||||
|
|
||||||
if api:
|
if api:
|
||||||
dump_api_message(
|
dump_answer(
|
||||||
"answer",
|
part=i_answer + 1,
|
||||||
{
|
answer=answer,
|
||||||
"answer": i_answer + 1,
|
answer_time=current - last,
|
||||||
"value": answer,
|
total_time=current - start,
|
||||||
"answerTime_s": (current - last).total_seconds(),
|
|
||||||
"totalTime_s": (current - start).total_seconds(),
|
|
||||||
},
|
|
||||||
)
|
)
|
||||||
else:
|
else:
|
||||||
print(
|
print(
|
||||||
|
|||||||
@@ -1,18 +1,78 @@
|
|||||||
from abc import abstractmethod
|
from abc import abstractmethod
|
||||||
from logging import Logger
|
from logging import Logger
|
||||||
from typing import Any, Final, Iterable, Iterator, Protocol, Sequence, TypeVar, overload
|
from pathlib import Path
|
||||||
|
from typing import (
|
||||||
|
Any,
|
||||||
|
Final,
|
||||||
|
Iterable,
|
||||||
|
Iterator,
|
||||||
|
Protocol,
|
||||||
|
Sequence,
|
||||||
|
TypeVar,
|
||||||
|
overload,
|
||||||
|
)
|
||||||
|
|
||||||
|
from numpy.typing import NDArray
|
||||||
|
|
||||||
_T = TypeVar("_T")
|
_T = TypeVar("_T")
|
||||||
|
|
||||||
|
|
||||||
class ProgressHandler(Protocol):
|
class ProgressHandler(Protocol):
|
||||||
@overload
|
@overload
|
||||||
def wrap(self, values: Sequence[_T]) -> Iterator[_T]:
|
def wrap(self, values: Sequence[_T]) -> Iterator[_T]: ...
|
||||||
...
|
|
||||||
|
|
||||||
@overload
|
@overload
|
||||||
def wrap(self, values: Iterable[_T], total: int) -> Iterator[_T]:
|
def wrap(self, values: Iterable[_T], total: int) -> Iterator[_T]: ...
|
||||||
...
|
|
||||||
|
|
||||||
|
class FileHandler:
|
||||||
|
@abstractmethod
|
||||||
|
def make_path(self, filename: str) -> Path: ...
|
||||||
|
|
||||||
|
@abstractmethod
|
||||||
|
def notify_created(self, path: Path): ...
|
||||||
|
|
||||||
|
@abstractmethod
|
||||||
|
def _create(
|
||||||
|
self, path: Path, content: bytes, text: bool = False
|
||||||
|
) -> Path | None: ...
|
||||||
|
|
||||||
|
def create(self, filename: str, content: bytes, text: bool = False):
|
||||||
|
path = self._create(self.make_path(filename), content, text)
|
||||||
|
|
||||||
|
if path is not None:
|
||||||
|
self.notify_created(path)
|
||||||
|
|
||||||
|
def image(self, filename: str, image: NDArray[Any]):
|
||||||
|
import imageio.v3 as iio
|
||||||
|
from pygifsicle import optimize # type: ignore
|
||||||
|
|
||||||
|
path = self.make_path(filename)
|
||||||
|
|
||||||
|
iio.imwrite(path, image) # type: ignore
|
||||||
|
optimize(path, options=["--no-warnings"])
|
||||||
|
|
||||||
|
self.notify_created(path)
|
||||||
|
|
||||||
|
def video(self, filename: str, video: NDArray[Any]):
|
||||||
|
import cv2
|
||||||
|
|
||||||
|
path = self.make_path(filename)
|
||||||
|
fps = 5
|
||||||
|
out = cv2.VideoWriter(
|
||||||
|
path.as_posix(),
|
||||||
|
cv2.VideoWriter_fourcc(*"vp80"), # type: ignore
|
||||||
|
fps,
|
||||||
|
(video.shape[2], video.shape[1]),
|
||||||
|
True,
|
||||||
|
)
|
||||||
|
|
||||||
|
for picture in video:
|
||||||
|
out.write(picture)
|
||||||
|
|
||||||
|
out.release()
|
||||||
|
|
||||||
|
self.notify_created(path)
|
||||||
|
|
||||||
|
|
||||||
class BaseSolver:
|
class BaseSolver:
|
||||||
@@ -23,15 +83,14 @@ class BaseSolver:
|
|||||||
year: int,
|
year: int,
|
||||||
day: int,
|
day: int,
|
||||||
progress: ProgressHandler,
|
progress: ProgressHandler,
|
||||||
outputs: bool = False,
|
files: FileHandler | None = None,
|
||||||
):
|
):
|
||||||
self.logger: Final = logger
|
self.logger: Final = logger
|
||||||
self.verbose: Final = verbose
|
self.verbose: Final = verbose
|
||||||
self.year: Final = year
|
self.year: Final = year
|
||||||
self.day: Final = day
|
self.day: Final = day
|
||||||
self.progress: Final = progress
|
self.progress: Final = progress
|
||||||
self.outputs = outputs
|
self.files: Final = files
|
||||||
|
|
||||||
@abstractmethod
|
@abstractmethod
|
||||||
def solve(self, input: str) -> Iterator[Any] | None:
|
def solve(self, input: str) -> Iterator[Any] | None: ...
|
||||||
...
|
|
||||||
|
|||||||
49
src/holt59/aoc/inputs/holt59/2015/day23.txt
Normal file
49
src/holt59/aoc/inputs/holt59/2015/day23.txt
Normal file
@@ -0,0 +1,49 @@
|
|||||||
|
jio a, +19
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
jmp +23
|
||||||
|
tpl a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
inc a
|
||||||
|
tpl a
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
jio a, +8
|
||||||
|
inc b
|
||||||
|
jie a, +4
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
|
jmp +2
|
||||||
|
hlf a
|
||||||
|
jmp -7
|
||||||
28
src/holt59/aoc/inputs/holt59/2015/day24.txt
Normal file
28
src/holt59/aoc/inputs/holt59/2015/day24.txt
Normal file
@@ -0,0 +1,28 @@
|
|||||||
|
1
|
||||||
|
3
|
||||||
|
5
|
||||||
|
11
|
||||||
|
13
|
||||||
|
17
|
||||||
|
19
|
||||||
|
23
|
||||||
|
29
|
||||||
|
31
|
||||||
|
41
|
||||||
|
43
|
||||||
|
47
|
||||||
|
53
|
||||||
|
59
|
||||||
|
61
|
||||||
|
67
|
||||||
|
71
|
||||||
|
73
|
||||||
|
79
|
||||||
|
83
|
||||||
|
89
|
||||||
|
97
|
||||||
|
101
|
||||||
|
103
|
||||||
|
107
|
||||||
|
109
|
||||||
|
113
|
||||||
1
src/holt59/aoc/inputs/holt59/2015/day25.txt
Normal file
1
src/holt59/aoc/inputs/holt59/2015/day25.txt
Normal file
@@ -0,0 +1 @@
|
|||||||
|
To continue, please consult the code grid in the manual. Enter the code at row 3010, column 3019.
|
||||||
@@ -0,0 +1,94 @@
|
|||||||
|
<[<<({{<{<[[([()][()()])<{[]<>}{<>}>><<<[]{}>>{<<><>>({}{})}>][<<<{}<>>([])>{<{}><()>}>]><(<{(()[]){[](
|
||||||
|
<{([({{[(<[({({}{})[()<>]}{{<>{}}[(){}]})]>({(<<<><>>{{}()}>)<<<[]><{}<>>><[{}[]]<<>[]>>>}))[{(<{([]
|
||||||
|
([<([({(<([<({()()}(<>[]))[<[]()>{<>{}}]>]<{{{{}{}}{()()})({[]}[<>{}])}>)>)}){<<{{(<<<()<>><<><>>>
|
||||||
|
[{{[<<[{([[{{[<>{}]<()<>>}[(()<>)[{}<>]]}<<[{}[]]([]<>)>{{[]{}}{()()}}>]][[{<({}{})<[]{}>>
|
||||||
|
<<{{<([(((([{<[]<>>{()<>}}(<<>[]>{(){}})]([{{}<>}<[]>](<[][]><{}()>)))))[({{{<[]{}>[()]}<<<><>>
|
||||||
|
<(<[{(<[{{{<{[[]<>]{<>()}}><[[{}()][(){}]]>}}<[<[<()()>({}<>)]><[{[]()}([][])](<(){}>[<><>])>]{
|
||||||
|
{[[<{{<<[[<<(({}<>){<><>})[[<>()][[]{})]>[[[{}[]]<<>>]{(<>[])}]>{{<<()[]>{<>{}}>[{[]<>}<[]{}>]
|
||||||
|
({[((((([{[({[{}[]]<[]()>}[({}{})<<>[]>])<[(()[])<{}()>]{[[]<>]{[]()})>](([({}<>)(()[])][<[]{}>])
|
||||||
|
{[[{[({(<<{<([{}<>])<({}<>)({}<>}>>[<[{}()]([]<>)>((<>())<[]{}>)]}<([(<>())[(){}]]{[{}<>]<[][]>}){<{<><
|
||||||
|
(<{<<[<<([[([<<><>>]<<{}()><[]<>>>)]][{(({<>{}}(()())))(<[()()]<[]()>>)}[[<<<>()><<>{}>>([{}<>][{}[]])]{<{(
|
||||||
|
<<[({{{{{[<([((){})([]())]<((){})({}[])>)[{[{}()]{[]<>}}]>([<{{}<>}><({}<>)({}[])>]<[{<>{}}
|
||||||
|
(([[{{({{{[<<{[]()}({})>{{{}()}[[]<>]}>{<([])>[[[]{}]]}](([<[]{}>]<<[]<>><{}[]>>))}}}(([[[{[<><>
|
||||||
|
<<[(<[{{<((<[<()>[<><>]][[<><>]([]())]>[({<>})<<()<>><{}[]>>])[[(<[]<>>([]())){{<>[]}(()())}]]){(<(<[]<>>
|
||||||
|
({[<<[[{<[[{{[()()]{()[]}}}]<{([{}{}]{[]()})[[()[]]<<>>]}>]>}[({((<{<><>)>{{[]()}{{}[]}}){([{}[]]<{}{}>)<
|
||||||
|
([{{<{[(<[<<[({}())({}())]>>[{[<<>[]>[<>()]]<(<>[]){()[]}>}(<<<>[]>[<>[]]>{<<>[]>{{}()}})]]{
|
||||||
|
<[{{<[((<([[{<<><>>{()}}{<{}[]><[]()]}]])<{({<()>{()[]}}(<(){}><[]<>>)){[({}[]){<>[]}]}}<<([()()]<()(
|
||||||
|
<{<{[(({(({({<[]>([])}<<()<>>{<>()}>){[[()[]]<{}()>]{({}[])[()<>]}}}<[<<{}()><[]{}>>({[][]}[()<>])}{<<[]
|
||||||
|
<[{{[<({(<[<[[()<>]({}[])]([{}[]]([]))>]{[{{<>[]}[[]{}]}(({}<>)<()[]>)]<<[()[]]>({(){}}<{}()>)>}>)}<<[[[[<<>(
|
||||||
|
{{<(<[((({(<[<[]{}>[(){}]](<{}<>>((){}))>){(({[]{}}<{}[]>){{<><>}[[]{}]}))}<([<(<>)>[<<>{}>[{}
|
||||||
|
<([({[<[(({[(({}))(<{}()><<>{}>)]<[{{}[]}{{}<>}]{[{}()]{{}()}}>})([[<(<>())({}{})>[<[]<>>[
|
||||||
|
{((<<<{<(<[[[<{}<>}]<(<><>)>]]<(([(){}]{[]()}))<({{}<>}<()<>>){<()<>>{(){}}}>>>{({({()[]}[<>
|
||||||
|
([<[[((<(<[<([{}[]])>{<(()<>)((){})>{<<>>(()<>)}}][{[(<>[])(<>[])]}[[{{}[]}[()()]]<<[]<>>{(){}}>]]><({(
|
||||||
|
[{<([[[{([{<<([]<>){<><>}>[<(){}>]><{[<>[]](()<>)}[{()()}]>}<({{{}{}}}{[{}{}]<<>()>})<(<[]<
|
||||||
|
(<({[{{[[(<[<(<>[])[[][]]>]{((<>[])({}<>))({[]<>})}>({<[()[]]]<{()[]}>})){(<(<<>[]>[<>{}])>{[({}<
|
||||||
|
(<{<(({[(({[[<<>{}>({}<>)]{({}{}){(){}}}]{(<(){}>[[][]])<{()<>}>}}[[[{[]{}}[()]]](([[]()][(){}]))])
|
||||||
|
([({<{[{<[{<({{}()}{{}()})>}]>}<<[[{{((){})<<>{}>}(({}[]){<>[]})}]]><[{{<({}<>)(()())>[{<>()}{{}()}]}{<{
|
||||||
|
<[{[({[<<[[<<{{}{}}<{}{}>>([<>][(){}])><<<{}{}>>>]]{([{[[]()][[][]]}<{[]<>}>]<<[<>[]][[]()]><<()[
|
||||||
|
[{({{{<<{[{([[()]({}[])]{[()()]})(((<>{})[[][]])<{{}{}}>)}]}>>}[((({{<([[]()][[]])}}{{<({}[])[{}
|
||||||
|
{[({<{<<{[(([<<>[]>({}{})>))]{(<{{{}<>}<<>{}>}>)}}><(<(({([]())(<>[])}{{[]()}{[][]}})<{(()[])[<>{}]}>){({
|
||||||
|
[<((<[<<(<<{<(<>)<[]{}>>[<[]{}><[]()>]}<((()[])((){}))[({}[]){[]{}}]>>([<[{}()][[]{}]>{{()[]}}][{[{}<>]<[]<
|
||||||
|
[<[({({[([{<(([]<>)({}[]))<{{}[]}[<>[]]>><[<{}[]>({}<>)]<(())>>]]([[[{[]<>}({}[])](<[]{}>{<>()
|
||||||
|
{[<<{(<[{(<[({[]{}}{[]{}}}]({<()[]><<>[]>}{<[]()>[{}{}]})>)}{[{(((<><>))(<[]<>>(()[])))[[<[]()>[{}()]](((
|
||||||
|
({[<<([[{(<<<{<>()}<{}<>>>[[[]{}){()}]><[[(){}]<[]<>>]({(){}}[[]{}])>>{[{[()<>][{}()]}][[[{}{}]<<>()
|
||||||
|
([(<((<{[[[[[{{}()}{()[]}]]<([[]<>])<[()<>][[][]]>>]][{([{()[]}(()[])]({<>{}}{[]()}))}({([[]
|
||||||
|
(({{[<<{(([{<{()()}[[]()]>{<()<>>[[]{}]}}{[<()()>[[]{}]]{([]())({}[])}}][(<{<>[]}[()()]><<()>(()())>)
|
||||||
|
[<(<{{{<{(<{(<<>[]><<>()>){<{}()><()<>>}}(<[<>{}]{<>{}}><[{}{}][<>()]>)>)}{{{(<(<><>)(<>())><{[]}([][
|
||||||
|
<<<{([[<[[[(([[]{}])<({}())(<>())>)({[<>{}]{[]()}}<<(){}>{(){}}>)]{([(()()>({}[])]((<><>)<
|
||||||
|
{{({<<<[[<(<{{{}<>}({}[])}{<{}<>><<>()>}>{({{}<>}({}()}){[[]<>]([]{})}}){{[[[][]](()())]}([<<>{}
|
||||||
|
<<[[<{{({<{[{<<>()><()()>}<[()<>]<()()>>]{(([]<>)[{}[]]){{{}<>}{[]<>})}}>{{<[<{}<>>({}())]
|
||||||
|
({[<[[{<<{{[{(<>{})}]{<[{}{}][[]()]>[[[]{}][()()]]}}[(<<{}[]>{<>[]}>{{{}<>}[(){}]}){{[<>{}]<{}{}>}{
|
||||||
|
(([<{<[[([[(((()<>))({{}[]}<()<>>))[[({}[])(())]<{(){})>]][{((()){[]()}){{()<>}{<><>}}}[{{()}{()[]}}]]]){{(({
|
||||||
|
{<[{(<[{[{{[<([]<>)<{}<>>>]}}]}]><{{<[[([{<>()}[[]{}]]({{}()}{<>{}}))]{([<[]{}>(()<>)]<[[]<>]([])
|
||||||
|
{[<<[<(<[{<<[{{}()}{<>{}}](<{}<>>({}<>))>><{<({}[])<()<>>>[[<>[]][<><>]]}[<(<><>){{}<>}>[<[]()>{[]}]]>}]{[<{<
|
||||||
|
(<({{[{<(<<<{[{}<>]({}[])}{[[]{}]<()[]>}>(<[[]()][()()]><[()[]][<>()]>)>>[(<<<{}()>{<><>}>>){<<{<><>}(
|
||||||
|
(<{[[{{<(<(<({{}<>}{{}()}){[()<>]<{}[]>}>[(<{}{}><[]()>)<({}<>){()()}>]){[[([]{}){{}[]}]<[{}{}]<[][]>>][{<()
|
||||||
|
[(<([({[[[<[[[[][]][{}{}]]([{}()]{<>{}})]{<{()()}<()<>>><{{}<>}<(){}>>}>]{{[([[][]]<()()>)
|
||||||
|
(<(<<({{(<[{{[()<>][<>{}]}[<[]<>>]}<<{[]{}}>[[{}()]{()()}]>]{[([()()]<<>>)({()<>}[<>[]])][{{[][]}(<>())}
|
||||||
|
[[((({(({{{[{{<>[]}[<>{}]}[[{}<>]([]())]][{(<><>)}]}][(<{{[][]}(<><>)}<[[]()]>>([[{}()]<[]<>>][<[][]>[()()]])
|
||||||
|
<{({(([((<[<{(()[])<[][]>}{<<><>><[]<>>}><<([]<>)([]<>)>>]{[<([]{}]{<>{}}>]}>[{[(([]{})[{}{}])[<<>{}
|
||||||
|
{(([<{(({<({{{{}{}}}[[[]]{[]()}]}{<[[]]<<>()>>(<()>[()<>])})>{{[(([]<>){{}()}){[{}]{{}<>}}]}([[([]{})]<[[](
|
||||||
|
<{[({<{[[[{{{[{}{}]}}([<[][]>[<>[]}][<<>()>{()}])}((<({}[])[<><>]>(((){})[{}()]))[[<{}[]>[(
|
||||||
|
{<[([(<((<<<<[{}[]]({}{})>((()())[(){}])><([[]{}][()<>])<<<>[]>([]<>)>>><[[((){}){[][]}}{[[]]
|
||||||
|
[{(<{<{<<({({(()<>){{}[]}}([[]()]{()<>}))(([[]<>](())))}<{({()[]}{[][]})}])>>}>(({[{[{{([]())(<><>)
|
||||||
|
<[[<([<<({[[(<[]()><<><>>)({<>})]{{<<><>>[()[]]}([()<>](()[]))}]((<{<>{}}<(){}>>))}<<[(<(){}><<>{}>)[[()[
|
||||||
|
<[{<<<{[{<{(<[<>{}][{}()]>((<>[])[<><>]))<[({}<>)<<>[]>]<(<><>)(<>{})>>}({<<[][]>([]<>)>([<>{}><<>[]>
|
||||||
|
[<<(<{((<([<({{}{}](<>[]))[[()<>]([][])]>((([])<(){}>))]){<{{<()[]>(()<>)}(<[]<>>([][]))}><[([(
|
||||||
|
{[[[{{<[[{<[<<<>[]>{<><>}>{<<>{}><[]<>>}]((<{}()>(<>[])))><<{<<>{}>{(){}}}([{}{}]<<>()>)><[{<>{}}]>>}]
|
||||||
|
((((([[(([{<({()[]}<()<>>)><<<<>()>({}{})>{{(){}}(<>[])}>}<<<{<><>}>><(((){})<[]()>){{()()}({}<>)}>
|
||||||
|
<<[<[{<[<[<{[[()[]]({}[])]{<{}<>>[{}{}]}}[([[][]])[([]())[[]<>]]]>[(<<{}()>(()<>)>{{[]{}}<{}{}>})({([
|
||||||
|
[{<(<{(<[<[[[{()<>}[[][]]][(()<>){{}[]}]](<{<>{}}[()[]]>(<[]>[{}()]))]([([<>{}]<()[]>){{<>{}}{()
|
||||||
|
<[<({<({[{({{(<>{}){[]()}}<{[]<>}[(){}]>}({[<>[]]{[]<>}}))<{([{}[]])(({}[]){(){}})}[{[[]<>]}[({}())[(){}]]]
|
||||||
|
[[[{<[((<[<{([[]<>]{<><>})<<{}[]>[[][]]>}{[[<>{}]]<<{}>([]<>)>}>{<{{<>[]}}[(<><>)[[]<>]])<{[(){}]<()()>}>}]{{
|
||||||
|
([(<({[[{<([{{<>{}}([]<>)}[[{}[]]{<>{}}]](<[{}<>]{[]()}><((){})[[][])>)){({{{}{}}{{}{}}}[<{}{}>({}<
|
||||||
|
<[{(((({[[{{({{}[]]<<>>)<{[]()}<()<>>>}((<(){}>([]{})))}{({[()()]([]<>)}<([]<>)[()()]>)<[{{}[
|
||||||
|
<[({[<<<<{[({{(){}}[{}<>}}(<<>[]>[[]()])){(<()[]><<>()>)}]}><({<[{()()}]({[]{}}<{}>)>[({[]
|
||||||
|
<<([[<{{([{<{([]{})[(){}]}{([]{})<{}[]>}><<(<>{})[<>()]>({{}<>})>}<[(<<>()><{}()>)<{()<>}<<>>
|
||||||
|
<[[[({[({<[{((<>[]]<{}<>>){<<>()>{[]()}}}<{<{}{}>[<>{}]}{{{}[]}{{}()}}>]{<{{()()}<[]<>>}((
|
||||||
|
[[({(([[(([<[([]<>){{}()}]>(<{{}{}}(()<>)>[{<><>}{{}<>}])]{{<[[]<>]>[[{}()]]}([<{}()>][([]{})<{}
|
||||||
|
<(([<{([[<[((([]<>)<<><>>){[[]()]({}{})})({{(){}}((){}]}({{}()}))]([<{<>()}<[]{}>><{[]{}}<(){}>>])>
|
||||||
|
<<[[{<<{[(<<{{[][]}[[]<>]}<<[][]><<>[]>]>([{<>}[<>[]]]{{[]()}<{}()>})>{({({}<>){[]<>}}[{<>{}}[<>[]]
|
||||||
|
((<<<<[[(({[[<()<>>[(){}]]{(<>()){<>{}}}]}{(([<>[]><<>()>)<<(){}><()()>>)[(<{}{}>((){}))[{[][]}(()<>)]]})){
|
||||||
|
[({(<{{<<<{<[{[]()}<<><>>][[()[]][<>[]]]>}>([([<[]<>>]{<<>()><()<>>})({<{}[]><()()>}[[[]()]])]<{<(()
|
||||||
|
([(<({[([{{{((()())[<>[]]){{[]<>}[{}{}]}}([{()<>}<{}()>])}}<{[({(){}}(<><>)}<(<>())>][<[(){}]{(){}}
|
||||||
|
{[[{((((([[{{[[]{}]({}{})}{[[]<>](()[])}}[{[()()]}((<>{})<(){}>)]]{(<{<>()}<(){}>>){(<{}()>{{}<>})({<>(
|
||||||
|
([[{<[<[[<<{<{()<>}[<>()]>[[[]{}]{{}{}}]}<[{{}[]}]>>{<{{<>{}}([]())}>[(<<>()>)(<{}()>[<>()])]}>{({<[()<>]
|
||||||
|
{(([{[{{(({(<[()[]][<>[]]>)<[(()<>){{}{}}]>}[(<<{}{}><{}<>>>){<[()()]<()()>>({[][]}<<><>>)}
|
||||||
|
<[{<(<<[{[({[({}<>)<<>[]>](<<>()>(<><>))})[([{<><>}<()()>])]]}]><<[<({{{<>}}<([]][<>{}]>}[<(())<<><>>>])
|
||||||
|
(<(({<[[{{[<[{<>[]}[()<>])((()()){{}[]})>]}}]]((<<<((({}{})<{}>){{{}<>}{<>}})[({{}()}{<>()}){{{}()}}]
|
||||||
|
{[<[{(([<[{{[([]{})<[][]>]{([][])[()<>]}}<<(()<>)>>}[[(({}{}){{}<>})]]]{{[(<{}{}>[{}()])({()()}
|
||||||
|
[{{((<<[[((<<{[]<>}<{}>>(<{}<>>{[]()})>({<()>([][])><[{}{}]{{}()}>))(({([]<>)([]())}<{[][]}<()>>)
|
||||||
|
({([{({[({[<({{}{}}([]()))(((){}){{}{}}>>({(()()){{}()}})]<[[{{}{}}<{}[]>]{<[][]><<>[]>}]({<<>[]>
|
||||||
|
{[({[{{[<[{([<{}{}>[(){}]](<{}<>>{{}()}))([([]()){()[]}]([{}<>]{<>{}}))}]>[{{[[{[][]}]]<((()[])([]{}))<[()
|
||||||
|
[[(({{{(([[[{[()()]([]())}((<>){{}{}])]]({<[<>]({}{})>([<>{}]{{}{}})})]))}[(<[[(([[][]]{<>{}}){{(){}}})
|
||||||
|
<(<({<{<[<(<{<()><<><>>}<<{}[]>([]<>)>>)<{<{[]{}}[{}()]>}([(()[]){[]<>}]{{<>()}{{}<>}})>}{[[{(()[]){(
|
||||||
|
[(<(<([{<[{<(<()>([]<>))[{()()}<{}<>>]><{([]())<<>()>}(<{}{}>[()[]])>}]<{<({[][]}<[]()>){{{}[
|
||||||
|
[<({<{(<<[[[<{()[]}{{}[]}>{[<><>]}]{[<()<>>({}<>)]}]][[{<[<>[]>([]())><{()()}{[]{}}>}([({}{})[[](
|
||||||
|
<<[[{{<<([[{[(()())[()]][[{}[]]{{}}]}[[({}<>){[]{}}]{{<><>}[()[]]}]]{<[(<>())]>{({{}()}(()<>))}}])
|
||||||
|
{<[{({[({{<({[{}()]([][])}([{}<>]{[]()}))[<(<><>)([]{})><{()()}(<>[])>]>{{(<[]<>>[{}])}[<{(){}}(<>
|
||||||
|
<{{(({([[<[{<(<>)([]{})>{<<>{}>{(){}}}}]{[<([]{})<{}{}>>[[<>{}]{()<>}]][{{<><>}([]())}({()<>}<()>)]}>]
|
||||||
|
{<{[{[({[(({<[{}()]({}[]}>[<()>]}{(<<>>)}))]})]{<{<{[[{(<>())[()[]]}[[{}{}][[]]]][([[]()]<{}<>>)[<[]{}>([]<>
|
||||||
|
((<{{<[[<{{([([]{})<<>()>]<(<>{})(()<>)))([{()()}(<><>)]<(<>)(<>{})>)}([<{(){}}<<>{}>>]<[([]<
|
||||||
|
[<<<{(((<<{([<()[]>({})]({<>()}(()())))({([])<<>>}((()[])[()[]]))}{<[<{}()>]<[{}{}]({}<>)>>{<<
|
||||||
|
[[[<<<<[{(<<[{{}[]}]<(<><>)(<>[])>><<<<><>][[][]]>(([]{}))>>([<[[]<>]<[]<>>><{()<>}([][])>]))}<(
|
||||||
|
<<{[[[{{{{[[(([]{}))([<>[]]<()>)][{(<>()){[]()}})]{(({<><>}{<>[]})[<<>[]>[()()]])}}}<{(<((<><>)(<>{}))<{
|
||||||
|
|||||||
@@ -0,0 +1,10 @@
|
|||||||
|
4738615556
|
||||||
|
6744423741
|
||||||
|
2812868827
|
||||||
|
8844365624
|
||||||
|
4546674266
|
||||||
|
4518674278
|
||||||
|
7457237431
|
||||||
|
4524873247
|
||||||
|
3153341314
|
||||||
|
3721414667
|
||||||
|
|||||||
@@ -0,0 +1,26 @@
|
|||||||
|
xq-XZ
|
||||||
|
zo-yr
|
||||||
|
CT-zo
|
||||||
|
yr-xq
|
||||||
|
yr-LD
|
||||||
|
xq-ra
|
||||||
|
np-zo
|
||||||
|
end-LD
|
||||||
|
np-LD
|
||||||
|
xq-kq
|
||||||
|
start-ra
|
||||||
|
np-kq
|
||||||
|
LO-end
|
||||||
|
start-xq
|
||||||
|
zo-ra
|
||||||
|
LO-np
|
||||||
|
XZ-start
|
||||||
|
zo-kq
|
||||||
|
LO-yr
|
||||||
|
kq-XZ
|
||||||
|
zo-LD
|
||||||
|
kq-ra
|
||||||
|
XZ-yr
|
||||||
|
LD-ws
|
||||||
|
np-end
|
||||||
|
kq-yr
|
||||||
|
|||||||
@@ -0,0 +1,50 @@
|
|||||||
|
14567892107654348943218769016567650154541210421036
|
||||||
|
03456783298993267654309458122168743243450344323145
|
||||||
|
12567654456780154327812367433059804012769455410234
|
||||||
|
03498012349876065016901056544965418765898766708943
|
||||||
|
12345101212145076545411034545878329658981055899854
|
||||||
|
09876876705034187632110123656789421047432765988765
|
||||||
|
67878965896123298901001656743078431236598894012034
|
||||||
|
50965014387654567650012349856127340012367653213125
|
||||||
|
41234321298347656543243492347833458903458743404987
|
||||||
|
30087430178298343650156781016942167812769252985676
|
||||||
|
21196567069121243761056432679851043212890101679854
|
||||||
|
33203498451080252852347841589765654301285234521763
|
||||||
|
14512432347890161943210950432106567610106501430012
|
||||||
|
01693501036543270856102167645656788943217432567897
|
||||||
|
32789672321015389987343078938765497654998549879898
|
||||||
|
45679987410234578101256560129812321067801456734787
|
||||||
|
03478756500187665432107452121901054328982340125676
|
||||||
|
12568767891098987013898943030810167017654321010210
|
||||||
|
21079458910127698123965436945107878988901267124378
|
||||||
|
30980349821034787654876327876716901210985458095469
|
||||||
|
45671210136765693454761016329825432345671329186954
|
||||||
|
12789800345876548763876125419434501654510413277843
|
||||||
|
03543211238989439012985630308765898746701204567832
|
||||||
|
14623400141232323101234521678906567239874343236901
|
||||||
|
25710519850541014143219834567611452108965650145690
|
||||||
|
76897678769650001054301712106320143210345789036781
|
||||||
|
87678989678742112363212601235431234321276988325432
|
||||||
|
90549876349233678478004592347842389123489676710876
|
||||||
|
21632305256104569589123487656965476016512369856945
|
||||||
|
52301014107012345670149874565456365017603450747832
|
||||||
|
65490123458912396501234563432147454328214921632401
|
||||||
|
86985432167905487654341012563038901039309834521321
|
||||||
|
97876789001856778761232127678127612398712701100410
|
||||||
|
89810678012760869890103238999210543125625632234509
|
||||||
|
76701549013451987217876434785695610034534548765678
|
||||||
|
05432432174012987301987325654780123435210159854789
|
||||||
|
12980120985123673458986510783279234987346543123898
|
||||||
|
43878921976034562567603412892168765679857012010187
|
||||||
|
34565437852178901070412103601001410012768001921236
|
||||||
|
45430566543065012181543014580432321003459122876545
|
||||||
|
50121098767654327892678877698569457654219433468904
|
||||||
|
23292145678954218983019988087658768894308596567812
|
||||||
|
14587239010563007654128679112565489765107687656521
|
||||||
|
05674678323472167659436543203474321087230156785430
|
||||||
|
96983565401089898748540987654589321098543243896543
|
||||||
|
87874328992396701037621296562105465407698012565432
|
||||||
|
78765017687478632128760345673456978312789801478521
|
||||||
|
29653078596569543019656921087567889213456700329650
|
||||||
|
12532169430430156010567892193610367804765410418789
|
||||||
|
03445678321321060123456543012323458912894321001678
|
||||||
|
|||||||
@@ -0,0 +1 @@
|
|||||||
|
2 77706 5847 9258441 0 741 883933 12
|
||||||
|
|||||||
@@ -0,0 +1,140 @@
|
|||||||
|
QQQQQQCCCCCCCCCCCCXXXXXXXXXXXXXXUUUUUUJEEJJJJJQQQQIIISSVVVVVVVVVMMMMMMMMMMMMMMMMMMVVVVVWWWWFFFFFFFFFFFFAFZZZZZZZZZZZMMMMMMMMMMMMMMMMMMVMMQQQ
|
||||||
|
QQQQQCCCCCCCCCCCCCCCCXXXXXXXXXXUUUUUUUJJJJJJJJIIIQIIIIVVVVVVVVVVMMMMMMFMMMMMMMMMMMMVVVWWWWWFFFFFFFFFFFFFFZZZZZZZZLLZMMMMMMMMMMMMMMMMMMMMQQQQ
|
||||||
|
QQQQQQCCCCCCCCCCCCCCCCCCCXXXXXXUUUUUUJJJJJJJJJIIIIIIIIIVVVVVVVVMMMFFFFFMMMMMMMMMMMWWWWWWWWFFFFFFFFFFFFFFFZZZZZZZZLLZMMMMMMMMMMMMMMMHMQQMQQQQ
|
||||||
|
QQQQQCCCCCCCCCCCCCCCCCCCXXXXXXXUUUUUUUJJJJJJJJIIIIIIIIIIVVVVVVVVMMMMFFFMMMMMMMMMMMWWFFWWWWFFFFFFFFFFFFFFFZZZZZZZZMMMMMMMMMMMMMMMHHMHQQQQQQQQ
|
||||||
|
QQQQQQCCCCCCCCCCCCCCCCCXXZXXXXXXUUUUUUJJJJJJJYIIIIIIIIIIVVVVVVVVVVVFFFBBBMMMMMMMMFFWFFWWWWFFFFFFFFFFFFZZZZZZZZZZZLLMMMMMMMMMHMMHHHHHQQQQQQQQ
|
||||||
|
QQQQQQCCCCCCCCCCCCCCCZZZZZXXXXXXXUUUUUJJJOJJJYIIIIIIIIIVVVVVVVVVVVBFFFBBBBMMMMMMFFFFFFWZWWWWFFFFFFFFFFZZZZZZZZZZLLMMMMMMMMHHHHHRHHHHHHQQQQQQ
|
||||||
|
QQQQQQCCCCCCCCCCCCCCCZZZZTTXXXUUUUUUUUUUUOJJJJIIIIIIIIIIVVVVVVVVVVBBFBBBBBMMMMMMFFFFZDZZZWWWFFFFFFFFFFZZZZZZZZZZLLMMMMMMMMMHHHHHHHHHHHQQQQQQ
|
||||||
|
QQQQQQCCCCCCCCCCCCCCZZZZPTTTXXXXXUXXUUUUUOOJUUUUUIIIIIIIVVVVVVVVVBBBBBBBBBBBMMMFFFFFZZZZWWWAAAFFFFFFFFZZZZZZZZZZZLMMMMMMMMMMMHHHHHHHHHQQQQQQ
|
||||||
|
QIIIIIICCIWCCCCCCCCZZTTTTTTTTXXXXXXXXUUUUOXJUXUUUIIIQQQQQQQVVVVVVBBBBBBBBBBBMFFFFFFFZZZZAAAAAFFFFFFFDZZZZZZZZLLLZLLLMMMMMMMMMHHHHHHJJQQQQQQQ
|
||||||
|
IIIIIIICCIIMMQCCCCZZTTTTTTTTXXXXRRXXXUUUGXXXXXUUUIIIQQQQQQQVVVVVVBBBBBBBABMBMFFEFFFFFZZZZAAAAFFFFFFFDAZZZAAAALLLLLLMMMMMMMMMHHHHHHHJJQQQQQQQ
|
||||||
|
IIIIIIIIIIIMMMCCCCTTTTTTTTTXXXXXRTRXXXRRRXXXKKUUUUIOQQQQQQQVVVVVBBBBBBBBBBMMMFFFFFFFZZZZZAAAAFFFFAAFFAZZAAAAALLLLLLLLLLMMMMMHRHHHHHHJJJQQQQE
|
||||||
|
IMIIIIIIIIINNNNNNNNTTTTTTTTTTXRRRRRRRRRRRXXXXKKUUKOOQQQQQQQTVVVVBBBBBBBBBMMMFFFFFFFFZZZZZZZAAAAAAAABAAAAAAAAALLLLLLLLLMMMMMRRRRHHHPIJJJJBBBE
|
||||||
|
GIIIIIIIIIINNNNNNNNTTTTTTTTTTXRRRRRRRRRRXXKXXKKUUKOOQQQQQQQTVVVBBBBBUUUUMMMMFFFFFFFFFZZZZFAAAAAAAAAAAAAAAAAAIILLLLLLLLFMMMMRRRRHHIIIJJJJBBBB
|
||||||
|
GIIIIIIIIIINNNNNNNNTTTTTTTTTXXRRRRRRRRRXXXKKKKKUUKOOQQQQQQQQQBBBBBBBUUUUMMMMFFFFFFFFFZZZFFFAAAAAAAAAAAAAAAAAAATLLLLLLLFMMMMRRRRIIIIIJJBJBBBB
|
||||||
|
GIIIIIIIIIINNNNNNNNTTTTTTTTYXYRRRRRRRRRRRRPKKKKKKKOOQQQQQQQQQBBBBUUBUUUVUMMMFFFFFFFFFZZHFAAAAAAAAAAAAAAAAAAAGTTTLLLLJLLJMRRRRRIIIIIIIBBBBBBB
|
||||||
|
GGGIIIIIIIINNNNNNNNNNNNNTTCYYYRRRRRRRRRRRRPKKKKKKKKKQQQQQQQQQBBUUUUUUUUUUMMMMFFSFFFFFFFFFAAAAAAAAAAAAAAAAAAAATTTLLLLJJLJRRRRRRIIIIIIIBBBBBBB
|
||||||
|
GGGIIBIIIIINNNNNNNNNNNNNTTCYYYYYRRRRRRRRRRKKKKKKKKKVQQQQQQQTUBBUVUUUUUUUUUUMMMFFFFFFFFFFFAAAAAAAAAAAAAAAAAAATTTTTTTJJJJJRRRRRRRPIIIIIBBBBBBB
|
||||||
|
GGGGGGIIIKINNNNNNNNNNNNNTTCYYYYYRRRRRRRRRKKKKKKKKKKKQQQQQQQFFFFFFFFFFUUUUJUFFFFFFXXFFFFFFAAAAAAAAAAAAAVAEACATTTTTTTTTJJRRRRRRRRPIIZZIBBBBBBB
|
||||||
|
GGGGGGIIKKKNNNNNNNNNNNNNTTTYYYYYRRRRRRRRHKKKKKKKKKKKQQQQQQQFFFFFFFFFFUQUUUGGPGFFFFXFFFAFAAAAAAAAAAAAAAAAERCTTTTTTTTTVVVNNNRRRRRPIIZLLPBWBBBB
|
||||||
|
GGGGGGGKKKKKPPNNNNNNNNNNPPPPPPYYRRRRRRRHHHKKKKKKKKKKTTTTTTTFFFFFFFFFFUUUUHGGGGFXFXXFFFAAAAAAAAAAAAAAAAAARRRTTTSVTTTVVVVNNNNNRRRRNILLLLWWBBBB
|
||||||
|
GGGGGGKKKKPPPPNNNNNNNNNNPFPPPPPPRRRRRRRRRRKKKKKKKKIIITTTTTTFFFFFFFFFFOUUHHGGGGFXXXXXFFFAAAAAAAAAAAAAAAARRRRTTAVVVVVVVBVVVNNNNVVLLLLLLLWBBBBB
|
||||||
|
GGGGGIIIKKKKPPNNNNNNNNNNPPPPPPPPPJJJIRRIIIKKKKKKKIIIITTTTTTFFFFFFFFFFODUHHGGGGGXXXXXXRFAAAAAAAAAAAAAAARRRRROTTVVVVVVVVVHVNNVVVVVVLVVLBBBBBBB
|
||||||
|
GGGGGGIIIKIKPPNNNNNNNNNNPPPPPPPPPJJIIIIIIIIIGIIIKIIIIITTTTFFFFFFFFFFFYDYHGGGGGXXXXXXXXCAAAAAAAAAAAAAAARRRRRRRRRRVVVVVVVHVVVVVVVVVLVVRRBBBBBB
|
||||||
|
GGGGIIIIIIIKPPNNNNNNNNNNPPPPPPPPPPJIIIIIIIIIIJIIIIIIIIPTTTFFFFFFFFFFFYYYHGGGGGGGXGXXXXCAAAAAAAAAAAAAARRRRRRRRRRVVVVVVVVHYVVVVVVVVVVVRRBBBBBB
|
||||||
|
GGGHIIIIIIIIPPNNNNNNNNNNPPPPPPPPPPIIIPPPPPPIIJIIIIIIIIIIGTFFFFFFFFFFFYYBBBBGGGGGGGGGCCCCCACAAAAAAAAAARRRRRRRRRRVRRVVVVVHYYVVVVVVVVVVVRRBBBGB
|
||||||
|
GGGGFFIIIIIIZZNNNNNNNNZPPPPPPPPPPIIPIPPPPPPIIIIIIIIIIIIIITFFFFFFFFFFFYYBBBBGGBGGGGCCCCCCCCCAAAAAAAARRXRRRRRRRRRRRRVVVVVVWYVVVVVVVVVVRRRBBGGG
|
||||||
|
TGGGIIIIIIIIZYNNNNNNNNZPPPPPPPPPPIIPPPPPPPPIIIIIIIIIIIIIDDFFFFFFFFFFFHHBBBBJGBGGGGCCCCCCCCAAACCCADDRRRRRRRRRRRRRRRRVLYYYYYYYVVVVVVVVRRGGHGGG
|
||||||
|
GGGIIIIIIIIIIINNNNNNNNPPPPPPPPPPPIIPPPPPPPPIIIIIIIIIIIICCDFFFFFFDDHHHHHBBBBBBBGGGGGGCCCCCCCCCCICDDDRRRRRRRRRRRRRRRXVLLYYYYYYVVVVVVVVVGGGHGGG
|
||||||
|
GGGIIIDIDIIIIYNNNNNNNNPPPPPPPPPPPPIIIIPPPPPIIIIIIIIIICCCCCFFFFFFDDHHHHBBBBBBBBBGGGGGCCCCCCCJJCCDDDDRRRRRRRRRRRUUUUYYYYYYYYYYYMMVVVVVZZGGGGGG
|
||||||
|
DGGGDDDDDIIIYYYYYYPPPPPPPPPIPPPPPPPIIIPPXXPPPXIIIIIIIICCCCFFFFFFDDDHHBBBBBBBBBBGGGGGCCCCCJJJJCDDHHHJHNNRRQRRRSSUUUUSYYYYYYYYYYYAVVVVVZGGGGGG
|
||||||
|
DDDDDDDDDDDYYYYYYYYYPPPPPPPIIPPPIIIIIIXXXXXPXXIIIIICCCCCCVFFFFFFDDDDHBBBBBBBBBBBAAGGCAADDDDDDDDDHHHJHNHHRRRMMSSUUUSSYYYYYYYYYYYQVVXXGGGEGGGG
|
||||||
|
DDDDDDDDDDYYYYYYYYYPPPIPPIIIIIIIIIIIIIIIXXXPXXXBBXCCCCCCFTFFFFFFDDDDHDBBBBBBBBBAAAAAXAAAAAADDDHHHHHHHHHHHMMMSSSUSSSSYYYYYYYYYYYQQVQQQGGGGGGG
|
||||||
|
DDDDDDDDYYYYYYYYYYYPPPIIIIIIIIIIIIIIIXXXXXXPXXXXXXCJCCCFFFFFFFDDDDDDDDDBBBBBBBBAAAAAAAAAAAADDDDHHHHHHHHHHMMHDSSSSSSSYYYYYYYYYUYYQQQGGGGGGGGG
|
||||||
|
DDDDDEDDYYYSYYYYYYYYTYIIIIIIIIIIIIIIIXXXXXXXXXXXXCCJCCCCFFFFFFDDDDDDBBBBBBBBBBBAAAAAAAAAAAAAAHHHHHHHHHHHHHMHHSSSSSSSYYYYYYYYYYYLQQQGGGGGGGGG
|
||||||
|
DDDDEEDDYYYYYYYYYYYYTYIYIYIIIIIIIIIIIIXXXXXXXXXXYJCJCCFFFFFFFFFDDDDDZZBBBBBBBBBAAAAAAAAAAAAAAHHHHHHHHHHHHHHHJJIBSSSSSYYYCYYQQQFQQQQNGGGGGGGG
|
||||||
|
DDDEEEEEEEYWYYYYYYYYYYIYYYIIIIIIIIIIXXXXXXXXXXXXJJJJJJFFFFFFFFFDDDDDZZBBBBBBBBAAAAAAAAAAAAANHHHHHHHHHHIIHHHJJIIBSSQYYYYYYQYQXXQQQQAKKGKGGGGG
|
||||||
|
EEEEEEEEEEEWWYYYYYYYYYYYYYYYIIIIXIXXXXXXXXXXXXXXXJJJJFFFFFFFFFFDDDDDDZZBBBBBBBAAAAAAAAAAAAAATHHHHHHHHHIIIIIIIIIIIQQQQYYYYQQQXXXQQQKAKKKKKKGK
|
||||||
|
EEEEEEEEEEEWWYWYYYYYYYYYYYYYYYIIXXXXXXXXXXXXXXXXJJJJFFFFFFFFFFFDDDDZZZZZBBBBBBBBAAAAAAAAAAAAAAHHHHHHHIIIIIIIIIIIIIQQQQQYYQQQQXQQQQKKKKKKKKKK
|
||||||
|
EEEEEEEEEEWWWWWYYDYYYYYYYYYYYYYIIXXXXXXXXXXXKKKJJJJJFFFFFFFFFFFFDDDDDZZZZZZZBBBBAAAAAAAAAAAAAEMHHHHHHIIIIIIIIIIIIIQQQQQQQQQQQQQQQQQQKKKKKKKK
|
||||||
|
EEEEEEEWWWWWWWWWWYYYYYYYYYYYYYYYIXNNNNXXXXXXXXJJJJJJJFFFFFFFFFFFFDDTZZZZZZBBBBBBAAJAAAAAAAAMMLLLLLLLLIIIXIIIIIIIIIQQQQQQQQQQQQQQQQQQKKKKKKKK
|
||||||
|
EEEEEEKKWWWWWWWWWYYYYYYYYYYYYYYVAZXXXXXXXXXXXXJJJJJJJFFFFFFFFFFFWDDDZZZZZZBBBBBBAPJJAAAAAAAAMLLLLLLLLIIIIIIIIIIIIIIQQQQQQQQQQQQQQQKKKKKKKKKK
|
||||||
|
EEEEKKKKKKKKWWWWTJYTYYYYYYYAYYAAAAFFVVVXXXXXXXXXJJJJJJFFFFFJFFBFGGGGDDZZZBBBBBBNPPPAARRRRMAMLLLLLLLLLIIIIIIIIIIIIIQQQQQQQQQQQQQQQQMMMKMBKKKB
|
||||||
|
EEEKKKKKKKKKWWWTTTTTTTYYYAYAAAAAAAAAVVVXXXXXXXJJJJJJJJJFFFFJJFBBGGGGGGGGGGZBBBBPPPPPARRRRMMMLLLLLLLLIIIIIKKKKKKKKKKKKQQQQQPQQQMQMQIMMKMBBBBB
|
||||||
|
GKKKKKKKKKKWWTTTTTTTTTYAYAAABAAAAAAAVVVVVXXVVBBJJJCCCJJJFFJJJMBBGGGGGGGGGGZBBBBPPPPPPRRRRMMMLLLLLLLLIIWIVKKKKKKKKKKKKQQQQPPQQQMQMMMMMMMBBBBB
|
||||||
|
GKKKKKKKKKKWWTTTTTTRTTYAAAAAAAAAAAAAVVVVVVVVVVJJJCCCCCJJJJJJJMMMGGGGGGGGGGBBBBBPPPPPJRRRRLRRRRRRRRLLMMIIIKKKKKKKKKKKKQQPQPNNNQMMMMMMMMMCBBBB
|
||||||
|
KKKKKKKKKKKKKETTTTTTTTAAAAAAAAAAAAAAAVVVVVVVVNCLJCCCCCJJJJJJJMMMGGGGGGGGGGBBBPBPPPPPJRRRRMRRRRRRRRLLVMMMVKKKKKKKKKKICCCPPPNNNQMMMMMMWWMMMMBB
|
||||||
|
KKKKKKKKKKKKKEETTTXXTAAAAAAAAAAAAAAAAVVVVVVVVLCCCCCCCJJJJJJJJJMGGGGGGGGGGGBBBPPPPPPPPRRRRRRRRRRRRRLLVVVVVKKKKKKKKKKCCCPPPPPNNNMMMMMMMMMMMMBB
|
||||||
|
KKKKKKKKKKKKKEEEEMXXXAAAAAAAAAAAAAAMAVVVVVVVLLLLLCCCCJJJJJJJJJMGGGGGGGGGGBBBBPPPPPPPPRRRRRRRRRRRRRLLVVVVVKKKKKKKKKKCCCPPPPPPNUMMMMMMMMMBBBBB
|
||||||
|
KKKKKKKKKKKKEEEEMMMMXXAAAAAAAAAAAAAAVVVVVVVVLLLCCCCCCJJJJJJJJJJGGGGGGGGGGBBBBPPPPPPPPRRRRRRRRRRRRRLVVVVVVKKKKKKKKKKCCPPPPPPPCMMMMMMMMMMMBBBB
|
||||||
|
KKKKKKKKYKKKKKKKKMMMMXAAQAAAAAAAAAAAVVVVVVVVLLGGCCCCCJJJJJJJJJJGGGGGGGGGGBBBBBPPPPPPPRRRRJRRRRRRRRLVVVVVVKKKKKKKKKKCCPPPPPMMMMMMMMMMMMMMBBBB
|
||||||
|
KKKKKKKKKKKKKKKKMMMMKMMQQQAAAAAAAAAAAVVVVVVVVVCCCCCCCJJJJJJJJJJGGGGGGGGGGUBBBPPPPPPPPRRRRJJJMLLLLLLVVVVVVKKKKKKKKKKPPPPPPPPPMMMMMMMMMMMMBBBB
|
||||||
|
ZKKKTTKKMMKKMMMMMMMMMMMMQQQAQAAAAAAAVVVVVVVVVVCCCCCJJJJJJJJJJJJGGGGGGGGGGUBBBBPPPPPAPPJJJJJJJJVVVZVVVVVVVKKKKKKKKKKKKKKKPPPPPMMMMMMMMMMMMBBB
|
||||||
|
ZZZTTTKKMMMMMMMMMMMMMMMMMQQQQAAAAAAVVVVVVVVVVCCCCCCJJJJJJJJJJJYGGGGGGGGGGUUBPPPPPPPPEJJJJJJJJJVZZZVVVVVVVVWWKKKKKKKKKKKKPPPPPAAMMMMMMMBMMBBB
|
||||||
|
ZZZTTTTMMMMMMMMTTTTMMMMQQQQQQAAAAOAAVVVVVVVVVXCKCCCCJJJJJJJJJJYGGGGGGGGGGBBBPPPPPJJJJJJJJJJJJZZZZZZVVVVVVVWWKKKKKKKKKKKKPPPQPAAMMMCMMMBMBBBB
|
||||||
|
ZZZTZTTMMMMMMMMTTTTMQQMQQRRQQQQAOOOOVVVVVVVVVXVVCCCCCJJJJJJJJJUUUUUUUUUUUBBBBBBBBBBJJJJJJJJJJZZZZZZVVZZZZWWWKKKKKKCCCCPMPPPAPPAAMMCMBMBBBBBB
|
||||||
|
ZZZZZZTMMMMMMMMTTTTTQQQQQRRQQQQOOOOOOOVOVVVVVVVVGGCCJJJJJJJJJJUUUUUUUUUUUBBBBBBBBBJJJJJJJJJJZZZZZZZZVZZZZZWWKKKKKKBCCCCPPPLAAAAAAABBBBBBBBBB
|
||||||
|
ZZZZZZZCCMMMMMMTTTTTQQQQQRRQROOOOOOOOOVOVVIIIVRVGGJJJJJJJJJUUVUUUUUUUUUUUUUBBBBBBBBBJDDJJJJJJZZZZZZZZZZZZZZWKKKKKKBBBCPPPPAAAAAAABBBBBBBBBBB
|
||||||
|
ZZZZZZCCCMMMMMTTTTTTQQQQQRQQRRROOOOOOOOOVVIIIVIGGJJJJJJJJJUUUUUUUUUUUUUUUBBBBBBBBBBJJJJJJJKKJJZZZZZZZZZZZZZWKKKKKKBBBKPKNKAAAAAAABBBBBBBBBBB
|
||||||
|
ZZZAZZCCCCMMMDTTTTTQQQQQQQRRRRROOOOOOOOOOIIIIIIGGGJJJJJJJJJUUUUUUUUUUUUUVVVVVVVVVBRJJJJJJJKIIIIIIIIIZZZZZWWWKKKKKKBBFKKKKKAAAAAAAABBAABBBBBB
|
||||||
|
ZZZAZZCCCCCMMDDKTTTQQQQQRRRRRROOOOOOOOOOOOIIIIIGAAJJJJJJJJJUUUUUUUUUVVYVVVVVVVVVVBRRJJJJJUUIIIIIIIIIZZZZZZWWKKKKKKBBBKKKIIIAAAAAAAAAAAAABBBB
|
||||||
|
ZAAAZZCCCMMMMDTTTTTQQQQQRRRRRRSOOOOOOOOOGOIIIIIAAAAJJJJJJJJMMMUUJUUXVVVVVVVVVVVVVBRRJJJZIIIIIIIIIIIIZZZZZZWWKKKKKKBBKKIIIIHHHZAAAAAAAAAABBBB
|
||||||
|
AAAROZOMMMMDDDGGTTTTQQRRRRRKRMOOOOOOOOOOOOIIAAAPAAAAAAAJJJJMVVVVVUUUVVVVVVVVVVVVVVRRRPJZIIIIIIIIIIIIZZZZZZWWWWWWWBBBKKKIHHHHHZAAAAAAAAAAAABB
|
||||||
|
AAOOOOOOMMDDDDDTTTTTQQRTRYRKROOOOOOOOOOOOOIIIAAAAAAAAAJJJJJVVVVVCCCCCVVVVVVVVVVVVVRRPPJZIIIIIIIIIIIIZZZZZWWWWWTWWWWBAAAHHHHHHHHHHAAAAAAAAABB
|
||||||
|
AAOOOOOODDDDDDQQTTTQQQRYYYRRYYOOOOOOOOOOOIIIIIAAAAAAAAAJJJVVVVVCCCCCCVVVVVVVVVVVVVVVVVWUIIIIIIIIIIIIZZZZZWWWWWTTWWWBBAAHHHHHHHHHMARAAAAOAAOC
|
||||||
|
AAAOOOOODDDDDDDQQTTQQQQYYYYYYYYOOOOOOOZOOIIIIAAAAAAAAAJJJJJVVVVCVCCCCVVVVVVVVVVVVVVVPUWUIIIIIIIIIIIIZZZZZWWWWZZZZZZZZHAHHHHHHHHHHAAOOOOOOOOC
|
||||||
|
AAAAAOJJDJDDDDDQQQQQQQQQYYOYYYYYYOOOOZZOZIIIIAAAAAAAAAJJJJJVVVVVVCCCCVVVVVVVVVVVVVVVNUUUIIIIIIIIIUGGZZZZWWWWWZZZZZZZZHHHHHHHHHHHMCOOOOOOOOOO
|
||||||
|
AAAAAAAJJJJDDDQQQQQQQQQQQYOYYYYYYYDOOZZOZIIIIAAAAAAAAAJJJJJJJVVVVVCCCCVVVVVVVVVVVVVVNNFUIIIIIIIIIUZZZZZZZTTWWZZZZZZZZHHHHHHHHHHHHCOOOOOOOOOO
|
||||||
|
AAAAAAAAJJDDDDDQQQQQQQQQQOOOWOOOODDOZZZZZZIIAAAAAAAAAAJJJJJJJVJVVDDDCCCVVVVVVVVVVVVNNNNUIIIIIIIIIUUUZZZZZPTTWTTTTWWHHHHHHHHHHHHHCCCCOOOOOOOO
|
||||||
|
AAAAAAAAAJJJDDQQQQQQQQQQOOOOOOODDDDZZZZZZZIIAAAAAAAAAAAJJJJJJJJJVDDDCCCCDKVVVVVVVVNNNNUUUUIIIIIIIUUUUZZZZTTTTITTTTWHHHHHHHHHHHHHCCCCCCCOOOOO
|
||||||
|
AAAAAAAAAAJBBQQBBBQQQQQOOOOOOOODZDDDZZZZZZIIAAAAAAAAAAAAJJJJJJJJDDDDDDDDDDDDVVVVVNNNNNNUUUIIIIIIIUUUUUZZZTTTTTTTTTHHHHHHHHHHHHHHCCCCCCCCOOOO
|
||||||
|
AAAAAAAAAAJBBBBBEBBBQQQOOOOOOOODZZZZZZZZZZZAAAAAAAAAAAAJJJJJJJJDDDDDDDDDDDDVVVVVNNNNNNNUUUIIIIIIIUUUUUUZTTTTTTTTTTTTHHRRHHHHHHHCCCCCCCOOOOOO
|
||||||
|
AAAAAAAAAAJBBBBBBBBBBOOOOOOOOOOOOOZZZZOZAAAAAAAAAAAAAAAAAJJJJJDDDDDDDDDDDDDVVVVVNNNNNNNNNNIIIIIIIUUUPPPKKKKTTTTTTTTTTHRRRHCCCHCCCCCCCCOOOOOO
|
||||||
|
AAAAAAAAAABBBBBBBBBBBOOOOOOOOOOOOOZZZZOZAOOAAAAAAAAGGGJJAJJJJJDDDDDDDDDDDDVVVVVVVVNNNNNNNNIIIIIIIUUPPPPKKKKTTTTTTTTTTTTRTTCCCFCCCCCCCCCOOOOO
|
||||||
|
AAAAPAAAAABBBBBBBBBBBYYOOOOOOOOOPOOOZOOOOOOOAAAAAAGGGGJJJJJJJDDDDDDDDDDDDDVVVVVVVVNNNNNXXNNNNNNNPPPPPPPKKKKTTTTTTTTTTTTTTCCCCCCCCCCCCCCCOOOO
|
||||||
|
AAAAPAAAAABBBABBBBBBBBYOOOOOOOOOOOOOOOOOOOAAAALALAGGGGGJJJJJDDDDDDDDDDDDDDDVVVVOOVVVXXXXXNNNNNNNPZZZZZZZZZZKTKTTKSTTNLLTTNCCCCCCCCCCCCCCCOOO
|
||||||
|
AAAAPPPAABBBBABBBBBBBBBBOOOOOOLLOOGGGOOOAAAAAALLLLLGGJJJJJJJDDDDDDDDDDDDDDDDVVOOOVVVWXXXXNNNNNNNPZZZZZZZZZZKKKKYYYYYYYYYYNNCCCCCCCCCCCCCCOOO
|
||||||
|
AAAAPPAAABBBBABBBBBBBBBBOOOOOOLOOOGGGOOOOAAAAAAALLLLJJJJJJJJJLLLDDDDDDDDDDDDDVOOOOVOWXXXXNNNNNPPPZZZZZZZZZZZZKKYYYYYYYYYYNNCCCCCCCCCBBCCOOOO
|
||||||
|
AAAPPPAPAAAABABBBBBBBBBPOXOOOOLOOOGGGOOOOOOAAAAALLLLLLJJJJJJJLLLLDDDDDDDDDOOOOOOOOOOWXXXXNNNNNNNPZZZZZZZZZZZZKAYYYYYYYYYYYYCCCCCCCXCBBCYOOOO
|
||||||
|
APPPPPPPPAAAAABBBBBBBBFZZXZZKKOOOOGGGOOOOOOAAAAALLLLZLJJJLJJJJLLLDDDDDDDDUUOOOOOOOOOOORRRRONOOPPPZZZZZZZZZZZZKAYYYYYYYYYYYYNCCUCCCCVBBCCPOHO
|
||||||
|
PPPPPPPPPAAAAAABBBBBBBBZZZZMOOOOOGGGGGOOOOOAAALLLLLLLLJJLLLLLLLLLLDDDDDDOOOOOOOOOOSOOOORDDOOOOPPMMMPPPPZZZZZZAAYYYYYYYYYYYYJMCCCCVVVBVPPPVVV
|
||||||
|
PPPPPPPPPAAAAAABBBBBBZBZZZZMMGGGGGGGGGGGGOOAZALLLLLLLLLLLLLLLLLLLLDDDDDOOOOOOOOOOOOOOOORDOOOOOPPMMMPPPPZZZZZZAAYYYYYYYYYYYYJMMMCCCVVVVVVVVVV
|
||||||
|
PPPPPPPPPAAAAAABBBBBBZZZZZZMMGGGGGGGGGGGGAAAZALLLZLLLLLLLLLLLLLLLLLDDDOOOOOOOOOOOOOOOOOOOOOOOOOPMMMPPPPPZZZZZAAYYYYYYYYYYYYJMJMMVVVVVVVVVVVV
|
||||||
|
XPPPPPPPAAAAAABBBTBBYZZZZZZZZYGGGGGGGGGGGGAAZZZLZZZLLLLBBBBLLLLLLLDDDDDOOOOOOOOOOOOOOOOOOOOOMMMMMMMPPPPPZZZZZAOYYYYYYYYYYYJJJJVVVVVVVVVVVVVV
|
||||||
|
XPPPPPPPAAJJAABAACBBYYZZZZYZYYGGGGGGGGGGGGAAZZZZZZLLBBBBBBBLLLLLBBBBBOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMJJJPLZZZZZAZYYYYYYYYYYYJJJJJJBJVVVVVVVVVV
|
||||||
|
XPPPPPPPJJJJAAAACCYBYYZYYYYYYYYGGGGGGGGGGGAAZZZZZZZZBBBBBBBLLLLLBBBBBBBBOOOOOOOOOOOOOOOOOOOMMMMMMMMMJJZZZZZZZZZYYYYYYYYYYYJJJJJJJJBVVVVVVVVV
|
||||||
|
XPPXPPPPJJJJAAACCCYYYYZYHYHYYYHGGGGGGGGGGGAAAZZZZZZZBBBBBBBBBLLBBBBBBBBBOOOOOOOXOOOOOOOOOOOMMMMMMMMMJJZZZZZZZZZZOOOOJJJYYYJJJJJJVJBVVVVVVVVV
|
||||||
|
XXXPPPPJJJJJJAACCYYHYYYHHHHHHHHGGGGGGGGGGGEAEZZZZZZZBBUBBBBBBBBBIIIBBBBOOOOOOOOOOOOOOOOOOOOOMMMMMMMMJJZZZZZZZZZOOOOOOJJYYYJJJJJJJJVVVVVVVVVV
|
||||||
|
XXXPPPPPPJJJJPACCCHHHYHHHHHHHHHGGGGGGGGGGEEEEZZZZZZZZUUUUBBBUUBBBIIIBIBBBOOOOOOOOOOOOOOOOOOOMMMMMZZZZZZZZKKZZZZZOOOOCCYYYYYYJJJJJJVVVVVVVVVV
|
||||||
|
XXXXPPPPPJJJPPAAAAHHHHHHHHHHHHYYYGGGGGEEEEEEZZZZZZZZZZUUUUUUUBBBIIIIIIIBBBOOOOMMMOOOOOOOOOYOMMMMMZZZZZZZZKKZZZZZZZOCCCYYYYYYJJJJJJVVQQVQQVVV
|
||||||
|
XXXPPPPJJQJJPPPAAHHOHHHHHHHHHHYYYYEEWEEEEEEEEZZZZZZZZUUUUUUUUUUIIIIIIIIIBOOOOOMMMMOMOOSOOOOOOMMMMZZZZZZZZKKZZZZZZZCCCCYYYYYYJJJJJJJJOQQQVVVV
|
||||||
|
XXXXXPPJJJJPPPPRROOOHHHHHHHHYYYYYYYEEEEEEEEEEEEZZZZUUUUUUUUUUUIIIIIIIIIIMMOOOMMMMMOMNNNOOOONNNNJEZZZZZZZZKKZZZZZZZCCCCYYYYYYJJJJJJJXQQQQQQQQ
|
||||||
|
XXJXXJJJJJJPPPRRRROOHHHHHHHHYYYYEEEEEEEEEEEEEEEZZZZZUUUUUUIIIIIIIIIIIIBBMMOOMMMMMMMMNNNCNNNNNNJJFZZZZZZZZKKKZZZCCCCCCCYYYYYYJJJJJJJQQQQUQQQQ
|
||||||
|
XXJJJJJJJJJPPYPVRJJHHPHHHHHHYYYYEEEEEEEEEEEEEEZZZZZZUUUUUTTIIIIIIINIIBBIMMMMMMMMMMMMNNNNNNNNNNFFFKKKKKKKKKKKZZZCCCCCCCYYYYYYJJJJJJCQQQQQQQQQ
|
||||||
|
XXJJJJJJJJPPJPPPPPJJJPPPHHHHHYYYEEEEEEEEEEEEXPZZZZZZZZUUUTTINNNNINNKIBIIMMMMMMMMMMMMMNNNNNNNNFFFFFKKKKKKKKKKZZZCCCCCCCYYYYYYJJJJJQQQQQQQQQQQ
|
||||||
|
XJJJJJJJPPPPPPPPPPJJJHHHHHHDHDYYYYYEEEEEEEEXXXZGGZZZZZUUUNNNNNNNNNNIIIIIMMMMMMMMMMMMNNNNNNNNNFFFFKKKKKKKKKKKKKKCCCCCCCYYYYYYYYYZZQQQQQQQQQQQ
|
||||||
|
JJJJJJJPPPPPPPPPPJJJJJJJJHHDDDDYYYYYEEEEEEEXXGGGGEEZZZUUDNANNNNNNNAIIIIIMMMMMQMMMMMMNNNNNNNNFFFFFKKKKKKKKKKKKKKCCCCCCCYYYYYYYYYZQQQQQQQQQQQQ
|
||||||
|
JJJJJJJJPPPPPPPPPJJJJJJJJJDDDDDYYYYEEEEEEXXXXXGGGGEEEZEUDNNNNNNNNAAAIIIIMMMMQQQQMMNNNNNNNNNNFFFFFCKKKKKKKKKKKKKKWCCCCIYYYYYYYYYZZZXQXQQQQQQQ
|
||||||
|
JJJJJJPPPPPPPPPPPJJJJJJJJJDDDDDDDYYEEEEEEXXXXGGSEEEEEEEENNNNNNNNNVVAAIIMMMMQQQQQMMNNNNNNNNNNOFFFFFKKKKKKKKKKKUUKKUCCCCCCCZYYYYYZZZXXXXQQQQQQ
|
||||||
|
HJJJJJPPPPPPPPPPPPPJJJJJJJJDDDDDDYYYEEEEEXXXSSSSEEEEEEEENNNNNNNNNNVAAAVVMQQQQQQQMMNNNNNNNHNNNFFFFFKKKKKKKKKKKUUUUUCCUUUUCCYYYYYXXXXXXXQQQQQQ
|
||||||
|
HJJJJNPPPPPPPPPPFPPJJJJJJJJDDDDYYYYXXNNEXXXSSSSSEEEEEEENNNNNNNNNNVVVVAVVQQQQQQQQMNNNHHNNNHNNNFFFFFKKKKKKKKKKKUUUUUUUUUUUUUUUHZZZXXXXXQQQQQQQ
|
||||||
|
HHJVJRPPPPPPPPPPPPPPLJJJJJJDDDLLLLXXXXXEXXXXXXXSUUUUNNNNNNNNNNNNNVVVVVVVQQQQQQQQMMMNHHHNNHHHHHHHHFHHHKKKKKKKKUUUUUUUUUUUUUHHHHHXXXXXXXQQQQQQ
|
||||||
|
HRRRRRRPRPUPPPPPPPPLLLLJJJDDDLLLLUUUXXXXXXXXXXXXXXUUUUNNNNNNNNNNNVVVVVVVQQQQQQQQMMMMHHHHHHHHHHHHHHHHHKHHHKKKKUUUUUUUUUUUUHHHHHHHHXXXXXXXQQQQ
|
||||||
|
HHHHRRRRRRRRRRPPPPWLLLLLLLLLDLLLLUUUVVVXXXCCCXXXXXXXKNNNNNNNNNNNNVVFVVVTTQQQQQQTMMMHHHHHHHHHHHHHHHHHHHHHHHKKUUUUUUUUUUUUUUHHHHHXXXXXHQHXQQQQ
|
||||||
|
HRRRRRRRRRRRRRRPPBGLLLLLJLLLLLLLLULUVVVXXCCCCCXXXXXXKKNNNNNNNNNNVVVVTTTTTTTTQQQTTTMLLHHHHHHHHHHHHHQQQHHHHUKUUUUUUUUUUUUQUUHHHXXXXXXXHHHHQHAH
|
||||||
|
RRRRRRRRRRRRRRRRPPGLLLJJJLJLLLLLLLLUVVVXCCCCCCXXXXXKKKNNNNNNNNNNVVVVTTTTTTTTTTTTTMMLLHLHHHHHHHHHHHQQQQHHHUUUUUUUUUUUUUUQUQHSXXXXXXXXXXHHHHHH
|
||||||
|
RRRRRRRRRRRRRRRRRGGGLJJJJJJLLLLLLLVVVVVECCCCMMMMMMKKKKKKNNNNNNNNNVVTTTTTTTTTTTTTULLLLLLHHHHHHHHHQQQQQHHHUUUUUUUUUUUUUQQQQQQSXXXXXXXXXXXHHHHH
|
||||||
|
RRRRRRRRRRRRRRRRRGGGGJJJJJJLLLLLLJVVVVVVGCCCMMMMMMKKKKKNNSSNNNNNNVTTTTTTTTTTTTTULLLLLLHHHHGGGGGHHQQQHHHHHUUUUUUUUUUUUQQQQQQSSXXXXXXXXXHHHHHH
|
||||||
|
VRRRRRRRRRRRRRRRRGGGJJJJJJJLLLLLLJVVVVVVGCCCMMMMMMKKKKNNGSGNNNNNYYTTTTTTTTTTTTLLLLLLLLLHHHGGGGQQQQQQHQHHHUUUUUUUUUUUUQQQQQQQSXXXAXXXXXHHHHHH
|
||||||
|
VVVRTRRRRRRRRRRRJGGGGQJJJJJJJLLLGVVVVVVGGCCCMMMMMMKKGKGGGGGGGGYYYYDTDTTTTTTTTTLLLLLLLLLHHHGGGGQQQQQQQQHHOOOOUUOOUUUUUQQQQQQQQXUAAXXMHHHHHHHH
|
||||||
|
VRRRTTTTRFFRRJRRGGGGQQJUJJJJJJGLLGGGGVGGGGGCMMMMMMKKGGGGGGGFFFYYDDDDDDDDTTTTTTTLLLLLLLLLHHGGGGQQQQQQQQQOOOOOUUOOUOUZUQQQQPQQUUUTTTTTHHHHHHHH
|
||||||
|
VVRAAATTYTFRYDDFGDGGQQJJJJJJGGGGGGGGGGGGGTTTTTTTMMKZGGGGFGGFFFYYDDDDDDDCTTTTTTTLLLLLLLLHHGGGGGGQQQQQQQOOOOOOOUOOOOOUGUUQQQQQUUUTTWTTKKNNHHNN
|
||||||
|
VVUUATTTTTDDDDDDMDGGQQJJJJJJGDGGGGGGGGGGGTTTTTTTKKZZGIIIFFFFFFYDDDDDDDDDDDTTTTTLLLLLLLLGGGGGGGGQQQQQQQOOOOOOOOOOOOWUUUUUUUUUUUUUUUKKKKKNHNNN
|
||||||
|
UUUUTTTTTQDDDDDDMDDDQQQQJJJJGDGGGGGGGGGGGTTTTTTTKKZZZIIIIFFFFDDDDDDDDDDHHHHTTTHLLLLLLLLIIGGGGGGQQQQQQOOOOOOOOOOOOOWKWWUUUUUUUUUUUUNNNNNNNNNN
|
||||||
|
UUUUTTTTTTDDDDDDDDDDDQQJJJCCDDGGGGGGGGTTTTTTTTTTCZZZIIIIIIFFFFDDDDDDDEDHHHHTHHHHLLLLLLLLLGGGGGGQQQQOQOOOOOOOOWOOOWWWWUUUUUUUUUUUUGNNNNNNNNNN
|
||||||
|
UUUUUTBTTTDDDDDDDDDDDDQJJJCCDDDGGDGGDGTTTTTTTTTTZZTZZIFFIFFFFFFDDDDDDDHHHHHHHHHLLLLLLLLLLGGGGGGQQQQOOOOOOOOOOWWWWWWWWUUUUUUUUUUUUNNNNNNNNNNN
|
||||||
|
UUUUUUUTTTTDDDDDDDDDDQQQQDDDDDDGDDDDDDTTTTTTTTTTNZZZZIIFFFFFFFFFDDDDDDDHHHHHHHHHHHLLLLLGGGGGGGGGGGOOOOOOOOOOOWWWWWWWWUUUUUUUUUUUUUNNNNNNNNNN
|
||||||
|
UUUUUUUTUUUDDDDDDDDDQQQQQQDDDDDDDDDDDDTTTTTTTTTTZZZZZFFFFFFFFFFFDFDDDZZZHHHHHHHHHHHHGGGGGGGGGGGGGOOOOOOOOOOOOOWWWWWWWWWWUUUUUUUUUNMNNNNNNNNN
|
||||||
|
UUUUUUUUUUDQDDDDDDDDQQQQQQDDDDDDDDDDDDTTTTTTTTTTZZZZZZZFFFFFFFFFFFDDDDZZHHHHHHHHHHGGGGGGGGGGGGGGGOOOOOOOOOOOOWWWWWWWWWWUUUUUUUUUUNNNNNNNNNNN
|
||||||
|
UUUUUUUUUDDDDDDDDDQQQQQQQDDDDDDDDDDDAZTTTTTTTTTTNZZZZFFFFFFFFFFFDDDDJJZZZHHHHFFFFFGGGGGGGGGGGGGGGOOOOOOOOOOOOOWWWWWWWWWUUUUUUUUUUUNNNNNNNNNN
|
||||||
|
UUUUUUUDDDDDDDDDDDQQQQQQQDDDDDDDDDDDDETTTTTTTTTTNPZZZFFFFFFFFFFFFIIZZZZZZZZFFFFFFFXGGGGGGGGLGGGGGGGOOOAAOOOOOOWWWWWWWWWUUUUUUUUUDUDNNNNNNNNN
|
||||||
|
UUUUUUUDDDDDDDDDDQQQQQQQQQDDDDDDDDDDDEEEVVVVVVVNNPZZZFFFFFFFFFFFDIDZZZZZZZZIIIIIIFXXXXGGGGGLLGGGGGOOOOOAOOOOOOOWWWWWWWUUUUUUUUDDDDDNNNNNNNNN
|
||||||
|
UUUUUUUDDDDDDDDQQQQQQQQQQVVVDDDDDDDDEEEEVVVVHHPNPPPZZZZFFFFFFFWWDDDZZZZZZZZZIIIIIIJXXJJGJJLLLLGGLGGOWWFAOAOOAOWWWWWWWWWWUUUUUUDDDDDDNNNNNNNN
|
||||||
|
UUUUUUUUDIDDDDDQQQQQQQQQQQVDDDDDDDDDDDEEEEVVVHPPPPPZZZZFZZZZZZWWDDDDDZZZZZZZIIIIIIJJJJJJJJLLLLLGLGGOWWFFFAAAAAWWWWWWWWWWUUZZUUUDDDDDDNNCNNNH
|
||||||
|
UUUUUUUUPDDDDDJJQQQQQQQVVVVDDDDDDDDDDEEEEEEVGPPPPPPZPZZFZZZZZWNWWWDDDDZZZZZZIIIIIIIJJIIILLLLLLLLLGLOWFFFFAAAAAWWWWWWWWWWWUZZUDDDDDDDDDNNNNNN
|
||||||
|
UUUUUUUUUDDDDDJJJQQQQQQQQQQQDTDDDDDDDDEEEEEPPPPPPPPPPPZZZZZZZWWWWWDDDDDZZZZZZNIIIIIIIIICCLLLLLLLLLLBFFFFFFFAAEWWWWWWWWWZZZZZZDDDDDDDDDDNNNNN
|
||||||
|
UUUUGGUUEEDDDDJJJJJJJQQQQQQQQDDDQDDDDEEEEEEEKPPPPPPPPPPZZZZWWWWPWDDDDDDZZZZZZNNIIIIIIILLLLLLLLLLLLLLFFFFFFFFFEWWWWWWWWWZZZZZDDDDDDDDDDDNNNNN
|
||||||
|
UUGUGGGEEEDJJJJJJJJJJJQQQQQQQDDDQQDDEEEEEEEEPPPPPPPPPPPZZWWWWWWWWDWDDDDZZZZZNNNNNIIIIILLLLLLLLLLLLLLLGFFFFFFEEEEEEWWWWZZQZZZDDDDDDDNNDNNNNNN
|
||||||
|
UGGGGGGGEEEJJJJJJJJJJJQQQQQQQQDQQQEEEEEEEEEEPPPPPPPPPPZZZWWWWWWWWWWWDDDZZZZINNNIIIIIIILLLLLLLLLLLLMGGGFEEEEEEEEEEWWWWWWZZZZZZDDDDNNNNNNNNNNN
|
||||||
|
UGGGGGGGGEJJJJJJJJQJQQQQQQQQQQQQQEEEEEEEEPPPPPPPPPPPPZZZZWWWWWWWWWWWDDZZNNNINNIIIIIIIILLGHLLLLLLLLLGGEEEEEEEEEEEEWWWWWZZZZZZZDDDDNNNNNNNNNNN
|
||||||
|
UGGGGGGGGGQJJJJJJJQQQQQQQQQQQQQQQQEEYEEYYYOPPPPPPPPPZZZWWWWWWWWWWWWWDDDNNNNNNNNIIINIIIIAGLLLLLLLLLLLGEEEEEEEEEEECPPPZZZZZZZZZDDNNNNNNNNNNNNN
|
||||||
|
SGGGGGGGGGJJJJJJJJQGQQQQQQQQQQQQQQQYYYYYYYYPYPPPBPZZZZZZWWWWWWWWWWWWNNNNNNNNNNNNNINIIIIGGLGGLLLLLLGGGGEEEEEEEEEECCPPPPPPZZZOZDNNNNNNNNNNNNNN
|
||||||
|
GGGGGGGGGGAJJJJJJJJQQQQQQQQQQQQQQQQYYYYYYYYYYPPPPZZZZZZZZZWWWWWWWWWRRRNNNNNNNNNNNNNIGIIIGGGLLLLGGGGGGEEEEEEEEEMMPCPPPPPPPPZZPPPPNNNNNNNNNNNN
|
||||||
|
GGGGGGGGGGGGJLJJJJJJDQQQTTTQQQQQQQQYYYYYYYYYYPYPYZZZZZZZZZZZWWWWWWWRRRNNNNNNNNNVVGGGGGGGGGGGLLGGGGGGGRNEEEEEEEMMPPPQPPPPPPPPPPPUNNNNNNNNNNNN
|
||||||
|
GGGGGGGGGGGGLLJJJJJTTDTQTTTQQQQQQEEEEEYYYYYYYYYYYYZZZZJZZWWWWWWWWWWRRRNNNNNNNNNNNRLLGGGGGGGGGGGGGGRRRRRREKKEEEMMPPPPPPPPPPPPPPPPZZZZZNNNNNNN
|
||||||
|
GGGGGGGGGGGGLYPPJJTTTTTTTQQQQQQQQEEEEEYYYYYYYYYYYYZZJJJJJJMWWWWWWWWWRRRRRNNNNRRRRRLLLGLGGGGGGGGGGGGRRRREEKKKKKKKUUPBPPPPPPPPZZZZZZZZNNNNNNNN
|
||||||
|
GGGGGGGGGGGGYYPPJJTTTTTTTTTTQQQQQEEEEEYPYYYYYYYYYZZZJJJJJJMMMWWWWWWWRRRRRRRRRRRRRLLLLLLGGGGGGGGGGGGRRRRRERKKKKKKKUPBBPPPPPPPZZZZZZZZZNNNNNNN
|
||||||
|
GGGGGGGGGGGYYYYYJJTTTTTTTTTQQQQQEOEEEEEYYYYYYYYYYZZZQJJJJJJJMWWWWWWWRRRRRRRRRRRRRLPLLLLLGGGGGGGGGGGRRERRRRRKKKKKKPPPPPPPPPPPZZZZZPZPPPPPNNNN
|
||||||
|
GGGGGGGGGGGYYYYYYJPTTTTTTTTTQQQQEEEEEEEYYYYYYYYYYYZJJJJJJJJJWWWWWRRWRRRRRRRRRRRRRLLLLLLLLGGGGGGGGGGGGRRRRRRRTKKKKPPPPPPPPPPPZZZZPPPPPPPPNNPP
|
||||||
|
GGGGGGGGGGYYYYYYYTTTTTTTTTTQQQQQEQEEEEEYYYYYYYYYYYZJJJJJJJJJJJWWRRRRRRRRRRRRRRRRRRRRLLLLLGGGGGGGGGGRRRRRRRRTTTTKTTPRPPPPPPPPZZFZPPPPPPPPNPPP
|
||||||
|
GGGGGGGGGGKKKKKKKKTTTTTTTTQQQQQQQQEYEEHHHHHHYYYYYYJJJJJJJJJJJJJRRRRRRRRRRRRRRRRRRRRRLLLLGGGGGGGGGGGGGRRRRRRRTTTTTTTPPPPPPPPRZZFZPPPPPPPPPPPP
|
||||||
|
|||||||
File diff suppressed because it is too large
Load Diff
@@ -0,0 +1,500 @@
|
|||||||
|
p=99,12 v=19,18
|
||||||
|
p=90,98 v=47,-52
|
||||||
|
p=86,3 v=82,-13
|
||||||
|
p=13,8 v=-67,-47
|
||||||
|
p=36,45 v=28,65
|
||||||
|
p=71,35 v=-8,-62
|
||||||
|
p=75,8 v=-30,-21
|
||||||
|
p=3,46 v=-38,-96
|
||||||
|
p=1,89 v=78,18
|
||||||
|
p=47,59 v=-63,99
|
||||||
|
p=92,78 v=68,48
|
||||||
|
p=42,31 v=78,94
|
||||||
|
p=75,29 v=9,83
|
||||||
|
p=46,12 v=-29,48
|
||||||
|
p=80,16 v=-70,33
|
||||||
|
p=18,66 v=57,-97
|
||||||
|
p=60,12 v=89,-90
|
||||||
|
p=21,36 v=-41,-78
|
||||||
|
p=75,53 v=52,-62
|
||||||
|
p=18,79 v=45,51
|
||||||
|
p=20,29 v=63,-97
|
||||||
|
p=22,68 v=23,1
|
||||||
|
p=6,67 v=-24,-44
|
||||||
|
p=44,35 v=-54,29
|
||||||
|
p=33,80 v=28,-56
|
||||||
|
p=48,78 v=55,-22
|
||||||
|
p=88,79 v=99,69
|
||||||
|
p=12,96 v=-50,-59
|
||||||
|
p=6,57 v=80,61
|
||||||
|
p=98,31 v=-77,14
|
||||||
|
p=91,65 v=-13,20
|
||||||
|
p=52,53 v=-85,41
|
||||||
|
p=94,94 v=-15,5
|
||||||
|
p=69,75 v=-41,-11
|
||||||
|
p=98,77 v=71,-54
|
||||||
|
p=23,47 v=-61,-27
|
||||||
|
p=32,74 v=-11,96
|
||||||
|
p=22,87 v=-5,-75
|
||||||
|
p=65,22 v=26,71
|
||||||
|
p=1,67 v=13,69
|
||||||
|
p=32,96 v=-90,-94
|
||||||
|
p=17,17 v=-5,71
|
||||||
|
p=57,85 v=-92,28
|
||||||
|
p=52,32 v=-41,69
|
||||||
|
p=13,85 v=-43,-83
|
||||||
|
p=51,39 v=-38,32
|
||||||
|
p=64,17 v=91,82
|
||||||
|
p=97,86 v=-69,-70
|
||||||
|
p=98,94 v=46,-21
|
||||||
|
p=43,31 v=61,-24
|
||||||
|
p=42,58 v=-51,-42
|
||||||
|
p=5,46 v=-4,91
|
||||||
|
p=65,52 v=10,50
|
||||||
|
p=23,6 v=-42,29
|
||||||
|
p=54,25 v=4,44
|
||||||
|
p=5,19 v=-77,-74
|
||||||
|
p=44,77 v=-23,-26
|
||||||
|
p=10,70 v=6,-72
|
||||||
|
p=38,101 v=-50,-36
|
||||||
|
p=9,49 v=35,72
|
||||||
|
p=64,14 v=77,-78
|
||||||
|
p=21,2 v=-67,-6
|
||||||
|
p=34,97 v=-73,-37
|
||||||
|
p=77,13 v=-30,60
|
||||||
|
p=50,40 v=83,-58
|
||||||
|
p=99,85 v=-59,-87
|
||||||
|
p=65,0 v=-76,-48
|
||||||
|
p=44,94 v=-45,34
|
||||||
|
p=5,59 v=92,35
|
||||||
|
p=73,100 v=93,-71
|
||||||
|
p=50,20 v=-74,-97
|
||||||
|
p=9,33 v=-10,-89
|
||||||
|
p=54,49 v=-46,99
|
||||||
|
p=99,100 v=92,51
|
||||||
|
p=84,94 v=-53,-45
|
||||||
|
p=92,13 v=-61,69
|
||||||
|
p=19,52 v=56,-12
|
||||||
|
p=20,52 v=-38,-90
|
||||||
|
p=98,12 v=99,-22
|
||||||
|
p=46,23 v=95,-32
|
||||||
|
p=84,100 v=-70,70
|
||||||
|
p=19,69 v=58,-52
|
||||||
|
p=77,67 v=-51,31
|
||||||
|
p=11,6 v=18,-67
|
||||||
|
p=11,22 v=-50,-82
|
||||||
|
p=73,43 v=25,79
|
||||||
|
p=60,16 v=-58,-36
|
||||||
|
p=86,18 v=-88,71
|
||||||
|
p=21,50 v=-50,-88
|
||||||
|
p=17,20 v=-65,-54
|
||||||
|
p=38,26 v=67,71
|
||||||
|
p=22,60 v=-46,15
|
||||||
|
p=81,46 v=-39,16
|
||||||
|
p=25,98 v=22,-41
|
||||||
|
p=9,72 v=-94,8
|
||||||
|
p=82,59 v=-46,-34
|
||||||
|
p=71,41 v=-23,45
|
||||||
|
p=74,1 v=-70,32
|
||||||
|
p=96,17 v=-37,95
|
||||||
|
p=39,45 v=-6,-23
|
||||||
|
p=46,4 v=61,55
|
||||||
|
p=41,100 v=-35,-10
|
||||||
|
p=65,75 v=-1,-26
|
||||||
|
p=8,21 v=7,-32
|
||||||
|
p=43,71 v=-12,73
|
||||||
|
p=85,67 v=58,-41
|
||||||
|
p=73,7 v=31,-89
|
||||||
|
p=85,71 v=-93,-72
|
||||||
|
p=54,83 v=-46,-75
|
||||||
|
p=13,66 v=-24,-98
|
||||||
|
p=67,13 v=21,-21
|
||||||
|
p=1,33 v=24,-66
|
||||||
|
p=71,27 v=54,-78
|
||||||
|
p=69,86 v=42,35
|
||||||
|
p=17,28 v=-83,94
|
||||||
|
p=92,19 v=25,-68
|
||||||
|
p=92,84 v=-31,16
|
||||||
|
p=32,26 v=-6,54
|
||||||
|
p=20,97 v=-16,36
|
||||||
|
p=1,102 v=13,9
|
||||||
|
p=59,26 v=-68,91
|
||||||
|
p=92,44 v=-20,30
|
||||||
|
p=16,45 v=-83,34
|
||||||
|
p=30,69 v=-75,-46
|
||||||
|
p=51,64 v=-73,68
|
||||||
|
p=53,29 v=-57,-61
|
||||||
|
p=14,100 v=-15,86
|
||||||
|
p=80,41 v=-20,-81
|
||||||
|
p=5,92 v=-60,1
|
||||||
|
p=91,10 v=-49,98
|
||||||
|
p=0,62 v=-79,9
|
||||||
|
p=40,1 v=3,-70
|
||||||
|
p=81,32 v=-53,41
|
||||||
|
p=53,18 v=-46,94
|
||||||
|
p=69,96 v=-95,-82
|
||||||
|
p=32,92 v=-69,-30
|
||||||
|
p=73,83 v=-59,-65
|
||||||
|
p=74,67 v=-8,-99
|
||||||
|
p=71,45 v=-58,60
|
||||||
|
p=35,29 v=-51,-92
|
||||||
|
p=68,15 v=-92,-55
|
||||||
|
p=74,3 v=26,30
|
||||||
|
p=67,25 v=-58,22
|
||||||
|
p=31,46 v=-73,-92
|
||||||
|
p=29,69 v=45,23
|
||||||
|
p=48,78 v=-23,-29
|
||||||
|
p=41,13 v=-45,-78
|
||||||
|
p=57,8 v=-3,26
|
||||||
|
p=45,53 v=45,4
|
||||||
|
p=37,23 v=-62,41
|
||||||
|
p=41,90 v=-35,55
|
||||||
|
p=88,96 v=53,-71
|
||||||
|
p=38,15 v=-90,71
|
||||||
|
p=62,20 v=4,-88
|
||||||
|
p=64,19 v=15,-85
|
||||||
|
p=96,61 v=10,81
|
||||||
|
p=19,81 v=57,-45
|
||||||
|
p=53,11 v=67,44
|
||||||
|
p=51,83 v=66,85
|
||||||
|
p=29,76 v=-84,-26
|
||||||
|
p=63,23 v=-13,14
|
||||||
|
p=23,51 v=-18,-52
|
||||||
|
p=23,41 v=73,-55
|
||||||
|
p=99,75 v=-32,-14
|
||||||
|
p=68,20 v=79,45
|
||||||
|
p=27,74 v=45,42
|
||||||
|
p=55,96 v=47,-73
|
||||||
|
p=87,29 v=-93,22
|
||||||
|
p=20,76 v=-49,88
|
||||||
|
p=11,78 v=-67,-41
|
||||||
|
p=31,78 v=-12,-99
|
||||||
|
p=21,49 v=64,9
|
||||||
|
p=56,45 v=10,-4
|
||||||
|
p=67,97 v=-59,92
|
||||||
|
p=96,58 v=-49,96
|
||||||
|
p=36,51 v=-68,8
|
||||||
|
p=18,10 v=-79,-60
|
||||||
|
p=25,7 v=47,-55
|
||||||
|
p=12,101 v=40,-52
|
||||||
|
p=83,57 v=-42,-38
|
||||||
|
p=62,89 v=77,20
|
||||||
|
p=8,49 v=51,-54
|
||||||
|
p=12,98 v=-20,53
|
||||||
|
p=47,89 v=35,68
|
||||||
|
p=46,16 v=89,6
|
||||||
|
p=72,34 v=37,45
|
||||||
|
p=61,31 v=49,76
|
||||||
|
p=42,98 v=64,17
|
||||||
|
p=27,41 v=71,27
|
||||||
|
p=50,8 v=-1,-63
|
||||||
|
p=97,5 v=-56,9
|
||||||
|
p=41,58 v=5,-38
|
||||||
|
p=66,101 v=-64,13
|
||||||
|
p=67,95 v=-40,18
|
||||||
|
p=94,41 v=-37,73
|
||||||
|
p=89,102 v=-4,2
|
||||||
|
p=44,51 v=-84,65
|
||||||
|
p=9,89 v=29,89
|
||||||
|
p=28,29 v=5,29
|
||||||
|
p=76,4 v=-89,8
|
||||||
|
p=75,93 v=-75,89
|
||||||
|
p=38,6 v=-73,-2
|
||||||
|
p=19,1 v=-95,-6
|
||||||
|
p=61,76 v=-69,23
|
||||||
|
p=6,27 v=64,-24
|
||||||
|
p=97,76 v=47,28
|
||||||
|
p=62,86 v=50,-61
|
||||||
|
p=85,50 v=-93,-92
|
||||||
|
p=10,76 v=-83,31
|
||||||
|
p=58,42 v=52,-81
|
||||||
|
p=47,42 v=16,38
|
||||||
|
p=3,17 v=-66,52
|
||||||
|
p=58,84 v=-59,-36
|
||||||
|
p=91,76 v=20,-68
|
||||||
|
p=9,62 v=-10,-23
|
||||||
|
p=45,99 v=-85,-2
|
||||||
|
p=0,8 v=-77,17
|
||||||
|
p=53,70 v=-41,-23
|
||||||
|
p=32,96 v=6,89
|
||||||
|
p=67,33 v=26,37
|
||||||
|
p=94,86 v=47,47
|
||||||
|
p=26,74 v=-39,12
|
||||||
|
p=19,15 v=-55,16
|
||||||
|
p=60,76 v=93,-98
|
||||||
|
p=44,71 v=-49,-38
|
||||||
|
p=35,77 v=-1,-7
|
||||||
|
p=68,98 v=32,89
|
||||||
|
p=10,54 v=-23,-24
|
||||||
|
p=63,10 v=-77,50
|
||||||
|
p=75,61 v=71,80
|
||||||
|
p=35,78 v=-5,-55
|
||||||
|
p=74,23 v=15,-45
|
||||||
|
p=10,68 v=52,-34
|
||||||
|
p=45,43 v=8,-67
|
||||||
|
p=12,76 v=24,-75
|
||||||
|
p=62,73 v=-86,77
|
||||||
|
p=9,82 v=-38,-64
|
||||||
|
p=1,95 v=25,-64
|
||||||
|
p=67,30 v=-69,-20
|
||||||
|
p=92,25 v=-79,75
|
||||||
|
p=42,19 v=-46,-78
|
||||||
|
p=3,98 v=35,-83
|
||||||
|
p=89,102 v=53,90
|
||||||
|
p=25,10 v=-5,37
|
||||||
|
p=46,0 v=-74,29
|
||||||
|
p=12,40 v=-79,92
|
||||||
|
p=13,21 v=-56,-44
|
||||||
|
p=63,49 v=77,-27
|
||||||
|
p=3,12 v=83,-67
|
||||||
|
p=48,42 v=72,-62
|
||||||
|
p=37,74 v=-46,16
|
||||||
|
p=25,75 v=51,-26
|
||||||
|
p=84,35 v=81,-43
|
||||||
|
p=38,40 v=-63,19
|
||||||
|
p=77,13 v=-64,-48
|
||||||
|
p=95,13 v=-82,-44
|
||||||
|
p=81,41 v=-19,-81
|
||||||
|
p=33,81 v=-64,41
|
||||||
|
p=69,75 v=65,35
|
||||||
|
p=30,76 v=45,39
|
||||||
|
p=48,72 v=-29,39
|
||||||
|
p=74,10 v=78,-61
|
||||||
|
p=70,17 v=9,52
|
||||||
|
p=11,67 v=46,-87
|
||||||
|
p=35,72 v=-11,-46
|
||||||
|
p=86,37 v=-82,60
|
||||||
|
p=99,24 v=-91,56
|
||||||
|
p=92,46 v=-54,-23
|
||||||
|
p=93,12 v=76,-9
|
||||||
|
p=92,43 v=-97,-75
|
||||||
|
p=3,72 v=10,-79
|
||||||
|
p=13,83 v=13,8
|
||||||
|
p=78,80 v=3,-60
|
||||||
|
p=81,41 v=84,-73
|
||||||
|
p=93,9 v=-25,36
|
||||||
|
p=78,96 v=20,-37
|
||||||
|
p=40,50 v=-78,59
|
||||||
|
p=66,21 v=85,78
|
||||||
|
p=37,67 v=56,53
|
||||||
|
p=49,62 v=-91,-63
|
||||||
|
p=59,54 v=60,-69
|
||||||
|
p=57,81 v=77,39
|
||||||
|
p=51,79 v=-19,-11
|
||||||
|
p=65,27 v=74,95
|
||||||
|
p=33,56 v=44,-27
|
||||||
|
p=7,43 v=80,38
|
||||||
|
p=11,19 v=36,-88
|
||||||
|
p=27,15 v=-95,44
|
||||||
|
p=2,76 v=-15,-53
|
||||||
|
p=90,40 v=-14,56
|
||||||
|
p=93,52 v=30,-92
|
||||||
|
p=31,42 v=56,-16
|
||||||
|
p=86,64 v=-25,-51
|
||||||
|
p=97,81 v=-76,-76
|
||||||
|
p=11,36 v=35,-77
|
||||||
|
p=9,94 v=-10,-48
|
||||||
|
p=35,3 v=68,-6
|
||||||
|
p=10,84 v=69,58
|
||||||
|
p=12,17 v=18,71
|
||||||
|
p=61,62 v=77,-4
|
||||||
|
p=6,93 v=29,-82
|
||||||
|
p=91,71 v=-49,62
|
||||||
|
p=84,5 v=26,-17
|
||||||
|
p=100,1 v=-22,-38
|
||||||
|
p=90,27 v=-34,-39
|
||||||
|
p=84,21 v=-68,-62
|
||||||
|
p=72,10 v=-70,63
|
||||||
|
p=83,20 v=42,-74
|
||||||
|
p=51,99 v=-57,51
|
||||||
|
p=13,56 v=-78,76
|
||||||
|
p=21,88 v=80,81
|
||||||
|
p=40,97 v=76,85
|
||||||
|
p=61,92 v=-97,-15
|
||||||
|
p=29,58 v=56,-88
|
||||||
|
p=90,0 v=-34,-2
|
||||||
|
p=35,46 v=-23,-35
|
||||||
|
p=88,49 v=82,-67
|
||||||
|
p=83,23 v=98,-1
|
||||||
|
p=19,80 v=-5,-98
|
||||||
|
p=21,45 v=-90,45
|
||||||
|
p=79,3 v=-14,-86
|
||||||
|
p=49,37 v=27,-54
|
||||||
|
p=95,0 v=-93,36
|
||||||
|
p=55,46 v=-63,26
|
||||||
|
p=38,78 v=-61,-97
|
||||||
|
p=91,61 v=-60,-92
|
||||||
|
p=44,15 v=-51,75
|
||||||
|
p=82,86 v=20,-72
|
||||||
|
p=93,69 v=8,-95
|
||||||
|
p=93,59 v=-37,50
|
||||||
|
p=73,50 v=-84,22
|
||||||
|
p=8,7 v=-50,25
|
||||||
|
p=97,46 v=-14,22
|
||||||
|
p=43,2 v=-96,44
|
||||||
|
p=29,32 v=-33,34
|
||||||
|
p=30,64 v=-56,-95
|
||||||
|
p=12,65 v=-38,54
|
||||||
|
p=64,54 v=-12,-54
|
||||||
|
p=32,29 v=66,-4
|
||||||
|
p=80,84 v=-24,34
|
||||||
|
p=2,93 v=53,-87
|
||||||
|
p=77,14 v=59,-82
|
||||||
|
p=12,25 v=-77,78
|
||||||
|
p=65,74 v=76,-61
|
||||||
|
p=93,89 v=-26,59
|
||||||
|
p=1,35 v=25,-12
|
||||||
|
p=100,26 v=1,48
|
||||||
|
p=28,79 v=-96,16
|
||||||
|
p=18,1 v=-16,2
|
||||||
|
p=42,38 v=-39,-31
|
||||||
|
p=35,76 v=-76,-93
|
||||||
|
p=28,6 v=78,24
|
||||||
|
p=36,33 v=-34,-5
|
||||||
|
p=26,73 v=-95,-95
|
||||||
|
p=96,22 v=-83,-25
|
||||||
|
p=82,74 v=-30,-76
|
||||||
|
p=9,98 v=46,-52
|
||||||
|
p=80,3 v=13,-65
|
||||||
|
p=65,11 v=68,-58
|
||||||
|
p=68,57 v=-13,57
|
||||||
|
p=91,2 v=27,-94
|
||||||
|
p=2,96 v=-16,-29
|
||||||
|
p=65,67 v=-6,-55
|
||||||
|
p=79,63 v=88,-19
|
||||||
|
p=17,12 v=-27,52
|
||||||
|
p=10,6 v=52,-86
|
||||||
|
p=3,74 v=-37,-61
|
||||||
|
p=90,47 v=14,68
|
||||||
|
p=77,87 v=-59,20
|
||||||
|
p=80,63 v=-98,8
|
||||||
|
p=20,27 v=-64,10
|
||||||
|
p=93,60 v=-54,-38
|
||||||
|
p=93,14 v=52,95
|
||||||
|
p=53,79 v=-63,-87
|
||||||
|
p=12,21 v=-10,-70
|
||||||
|
p=71,62 v=76,-19
|
||||||
|
p=77,13 v=-3,-48
|
||||||
|
p=51,99 v=-46,-36
|
||||||
|
p=58,50 v=77,-31
|
||||||
|
p=59,62 v=54,43
|
||||||
|
p=66,66 v=-86,12
|
||||||
|
p=34,87 v=-93,-88
|
||||||
|
p=93,64 v=-47,71
|
||||||
|
p=11,5 v=1,-67
|
||||||
|
p=54,11 v=-80,-13
|
||||||
|
p=74,31 v=-30,-85
|
||||||
|
p=25,60 v=6,-34
|
||||||
|
p=94,77 v=81,73
|
||||||
|
p=62,70 v=-41,54
|
||||||
|
p=44,70 v=-68,80
|
||||||
|
p=25,78 v=42,71
|
||||||
|
p=46,0 v=-29,82
|
||||||
|
p=6,4 v=9,76
|
||||||
|
p=34,40 v=-52,3
|
||||||
|
p=62,23 v=2,50
|
||||||
|
p=85,72 v=31,27
|
||||||
|
p=85,67 v=1,1
|
||||||
|
p=3,37 v=-15,-96
|
||||||
|
p=99,29 v=-65,15
|
||||||
|
p=65,67 v=-22,-99
|
||||||
|
p=72,65 v=55,6
|
||||||
|
p=38,97 v=56,-52
|
||||||
|
p=16,13 v=35,82
|
||||||
|
p=0,7 v=-8,-86
|
||||||
|
p=47,4 v=33,-14
|
||||||
|
p=50,34 v=-26,59
|
||||||
|
p=27,61 v=60,81
|
||||||
|
p=100,11 v=13,-93
|
||||||
|
p=94,33 v=-26,-35
|
||||||
|
p=9,43 v=52,68
|
||||||
|
p=23,73 v=-1,-50
|
||||||
|
p=76,88 v=62,-78
|
||||||
|
p=62,28 v=43,3
|
||||||
|
p=95,22 v=-80,79
|
||||||
|
p=43,81 v=-84,40
|
||||||
|
p=19,10 v=85,2
|
||||||
|
p=40,31 v=-45,-81
|
||||||
|
p=33,59 v=11,-80
|
||||||
|
p=53,66 v=27,12
|
||||||
|
p=52,94 v=5,24
|
||||||
|
p=3,96 v=-71,-33
|
||||||
|
p=18,48 v=28,-27
|
||||||
|
p=76,18 v=34,-7
|
||||||
|
p=75,73 v=93,-53
|
||||||
|
p=48,9 v=-12,48
|
||||||
|
p=65,51 v=-69,-66
|
||||||
|
p=78,10 v=-14,-40
|
||||||
|
p=44,32 v=-52,7
|
||||||
|
p=36,20 v=-68,48
|
||||||
|
p=4,58 v=63,61
|
||||||
|
p=12,62 v=-39,-53
|
||||||
|
p=31,36 v=56,-85
|
||||||
|
p=14,58 v=-51,-61
|
||||||
|
p=86,11 v=-76,-17
|
||||||
|
p=45,38 v=-79,-1
|
||||||
|
p=60,41 v=29,18
|
||||||
|
p=28,8 v=-22,-59
|
||||||
|
p=66,47 v=-13,72
|
||||||
|
p=91,15 v=-31,-55
|
||||||
|
p=69,73 v=15,-87
|
||||||
|
p=52,49 v=71,-76
|
||||||
|
p=73,69 v=-47,-49
|
||||||
|
p=87,7 v=-20,-94
|
||||||
|
p=1,0 v=-76,40
|
||||||
|
p=96,48 v=-14,88
|
||||||
|
p=52,36 v=-46,26
|
||||||
|
p=94,48 v=3,-39
|
||||||
|
p=36,38 v=-71,-93
|
||||||
|
p=64,8 v=55,-47
|
||||||
|
p=75,63 v=59,-38
|
||||||
|
p=64,97 v=15,-94
|
||||||
|
p=63,102 v=4,-40
|
||||||
|
p=41,78 v=16,-87
|
||||||
|
p=63,82 v=58,50
|
||||||
|
p=32,24 v=48,42
|
||||||
|
p=57,69 v=-35,31
|
||||||
|
p=73,26 v=-2,-28
|
||||||
|
p=31,89 v=28,32
|
||||||
|
p=82,93 v=-14,62
|
||||||
|
p=61,87 v=-12,-26
|
||||||
|
p=58,36 v=-72,-13
|
||||||
|
p=80,49 v=-59,15
|
||||||
|
p=34,10 v=72,40
|
||||||
|
p=4,82 v=41,16
|
||||||
|
p=46,12 v=5,82
|
||||||
|
p=81,17 v=75,-36
|
||||||
|
p=69,12 v=99,90
|
||||||
|
p=98,16 v=-55,-24
|
||||||
|
p=49,39 v=38,-89
|
||||||
|
p=91,1 v=92,-32
|
||||||
|
p=91,99 v=-48,-33
|
||||||
|
p=16,44 v=-60,53
|
||||||
|
p=26,60 v=-56,-31
|
||||||
|
p=31,32 v=28,-16
|
||||||
|
p=36,40 v=33,-47
|
||||||
|
p=60,18 v=-97,-51
|
||||||
|
p=5,2 v=36,-21
|
||||||
|
p=83,8 v=20,-47
|
||||||
|
p=32,40 v=-16,-39
|
||||||
|
p=65,11 v=-84,11
|
||||||
|
p=58,31 v=-80,-5
|
||||||
|
p=96,38 v=-42,-65
|
||||||
|
p=40,23 v=14,87
|
||||||
|
p=36,81 v=67,77
|
||||||
|
p=13,74 v=35,96
|
||||||
|
p=6,58 v=-36,-64
|
||||||
|
p=73,23 v=-53,-5
|
||||||
|
p=22,18 v=45,-58
|
||||||
|
p=67,29 v=-81,-52
|
||||||
|
p=14,18 v=-33,-17
|
||||||
|
p=51,28 v=43,-55
|
||||||
|
p=98,11 v=-72,95
|
||||||
|
p=80,17 v=-53,10
|
||||||
|
p=76,54 v=65,-77
|
||||||
|
p=76,98 v=-74,66
|
||||||
|
p=12,50 v=97,64
|
||||||
|
p=53,27 v=67,26
|
||||||
|
p=22,89 v=57,-60
|
||||||
|
p=23,34 v=40,-43
|
||||||
|
p=35,85 v=17,-6
|
||||||
|
|||||||
@@ -0,0 +1,71 @@
|
|||||||
|
##################################################
|
||||||
|
##.OO.O.O#........#..O.......O......O..O..O.O...O#
|
||||||
|
#O.O#.O......#.#O......O....O.O.....#.#.......#..#
|
||||||
|
#.##O.O..#OO...O..O.O..O#.#.O.............O..OO..#
|
||||||
|
#.OO#......OOO.OO.OO.O...O.O.................O.O.#
|
||||||
|
#.#....#O.......O.#OO.#..O#.O...O.O...O....O.O#O.#
|
||||||
|
#O..O...#O.O..#OO#O....O...#....OOO...O.###.#.OO.#
|
||||||
|
#.....O.....OO..O......O......O..........OOO..OO##
|
||||||
|
#.O#..O...O.......O.....OO...O#...O..OO...O......#
|
||||||
|
#O....O...#O......O..O.OO....O..O.OO....#......O##
|
||||||
|
##.O..O..#.OO#....#..O.#......O....#.....O..O#..##
|
||||||
|
#..#....OO.##.......O..O..#.#..O.O...OO#..O#....O#
|
||||||
|
##O.O....O.O.O....OO...O.......O#..........O..O..#
|
||||||
|
#.##.O.OO..................#.##O.O...#OO.......OO#
|
||||||
|
#O....#O.....OOOO.O.#.OOO#O.....OO...OO..O....#..#
|
||||||
|
#.#O.O.......OO..OO.O..O..#.O.O......O.O..#O.O...#
|
||||||
|
##..OO.O...#.....O#O.O..O.OO#.O.OOO...O....#O.#.O#
|
||||||
|
#....O.....O#O..O.O..O...............OO.O.O.O.OO.#
|
||||||
|
#.OO.O...O..O..OO#O..#....OO...O...O.O#.O.#......#
|
||||||
|
#..OO.....O...O..#O........O..O.O.O..#...O...#...#
|
||||||
|
#O......OO.O.........O#OOO.O..O...OO..........#O.#
|
||||||
|
#.O.....#.......#O......O........#.O.O...OO.O..OO#
|
||||||
|
#.#OO...#.#.O...OO.O.....#OO.O...O.....O.O#.O.O..#
|
||||||
|
#.O........#.O..O.O..#.#O#.OOO.....O..#.....#....#
|
||||||
|
#..O.O..#O#....OO#OO.#O#@.O..O.O.#...#.O.........#
|
||||||
|
#O....O.....O...O.#........O.OO.O..#...O....OO...#
|
||||||
|
#..OO.....O#.........O#........OOO...OO...#O#O..O#
|
||||||
|
#O....O...#O.O......O..OOO....OO#O..OO...........#
|
||||||
|
#O#.O..O...OO..........O.O...O.......OOO.........#
|
||||||
|
#...O.....O...O..#OOOO..O......#....#.O....O.....#
|
||||||
|
#..O..O.OOOO.O.......O.....O...#....O...O..OO.O.O#
|
||||||
|
#..OOO..O..OO.OO..O......O...#O...#.....O.....O..#
|
||||||
|
#..OO.O..O..#O....OO.....OO..O#O..#..O.#..#....O.#
|
||||||
|
#.O.#.#..##O.....O.....#OO...#......O.OO.O..OOOO.#
|
||||||
|
#..OO.O..O#.....#....O#......#......#.O..#..O..O.#
|
||||||
|
#O#...O.O..#....O.OO#.O.#....O.....#O......O..O.##
|
||||||
|
#......##O.OO.O#.O...O..OO#.O..###........O.OOO..#
|
||||||
|
#...O..#..O....O.#..#......O..O..#O...O...O......#
|
||||||
|
#.OO.OOOO.OO..#...OO......O.O.....O...O....#..O#O#
|
||||||
|
#O..#OOOO..#.O.O.......O...O.OO...O.........OO...#
|
||||||
|
#.O.....OO..O.....O.O#..OO...O#......O.....O....O#
|
||||||
|
#O.O..O.O...OO.O.....##...O..O....#O...OOO...O.#.#
|
||||||
|
##.O..O.O.O..##O#......O.OOO.#.....O.....O..#....#
|
||||||
|
#....#...O#...#..##.O.............O..#O..O..#.O..#
|
||||||
|
#...O..O#O....O...O...#.....O#OO...O.....#.O.....#
|
||||||
|
#.#O...O.O.O..O.#.O....O..O#..O.OOO..O....OO.....#
|
||||||
|
#......O..........O..#.#.....O...O..OO..O.O.##..##
|
||||||
|
#.O..O..OO.OOO..O...O.....O....O.......OOOOOO.O..#
|
||||||
|
#...#.O.#O#....#.O....OO..O.##....O.O.#.....#..O.#
|
||||||
|
##################################################
|
||||||
|
|
||||||
|
>vv^v>^^<>vv>v>^^<<^^>>^><^v<v<^>>v^><><<<<vv<^vv<^<>>><<v<^>>>>^^>>>v^v>^<v>>^^<>>^>^v><vv>v<^<^>><<v>^v^^v<^><<<<^><^v>^<>>^^vv<<<v^^><>vv<<<^<^v<>v<<<>>>v>v^>><v<>>^v^<v^v><<v<<^>^^<<^v>^v>vv^<><v^<v<^>v^<>^><<<^>>>^v^>>^^^^<<v<^>vv<^<><<>vvv<><vv><><v><^<v^^^v><<<<<vvv<>^<^>>vv^^^>v^>^v^^^v>^^><<<>^^v>^<^<>vv>>v^v<^^<<v><>>><^^v^<^<^v<^><^vv>vvvvv><>v<^^v<^v<<v>>>v<v<<>>^<v^>vv^>v<<^^<^<>v<><^v>vv>>^>><v<v<>^^<^><>v<v<>^^<v^vvv>>><v>><vvv><>v^v^<^<<v<v^^v<^^v^>^vv>^^<>v^^^^>vv<v^^^<^^v^^<>^><v><>v>^<v^vvv^<<^>>^^>^<>vv>v>v<^><v^v^<>^<^^><>^<v>vv<>v>^>>v^^^^>>v<v<^v<<v<>v<>^<>vv<>><<>v<vv^^<v<v^<^><v>^^^<^>vvv<^<<vv<v>^^^^<^>>><>>>v>>v><^<vv^<v^<^vv>><>v^<v<>>>><<v><v^>v^v^^<v<v<^v>^><<>>>v<v^<<>^^^^^v^^^<<v^<v>>>v<^vvv^>>^v^<^vv^v>^vvv>>^^^>v^>>^><^>^^<^<<^v><^<^<<>^^<<^<vv>>v^vvvvvv><v<^^v><^><><>^<<>v^><<>v<v>><<v^^vv^^v<>^>>>>>^>>^>><<v>v<v<>^>v<v^v^^<^<vv^^>>v>v<<<>^v^<<<^>^>^vv^^>v>>>^^>><v><>^<><^>><v>>v^<<<<^v^>v^>^v^v<>v^>v<^v><<>^^<>>v<>^<>vv^>v>^v<^><v>v><^><<<^>>v^<<>>^v
|
||||||
|
<>>>^v<<>^<<v<>^<>>><^v<<<>^<^<<vvv>^<v><>^vv^<<>v^vvv<<^v><>^v>^v><v<>>>^vv^v<vvv>^<>^<v<^^<>vvv<<^>v^^^v^>>^vv>^vv>^^>>>^<v<^v<vv>^>v>v<v<>><vv<^v>^^^vvv^^vv<>^<v><^>^<^>>v>><>><^v>^>^>^^<<vv>v>v>>^<^><<^<v<<<^<v><<^v^><^><v^^<^^<<<><>>^v><^^<<>>v^^<^v><^<v>v><>><>v<>^v^<<>>v^<>><<^<<v>^<^>v<v<vv<<v><<^<<>>v>>^>v<v^><^>^><<<><v<<<^^>vv<v^^vv^>>><v^<>v>^v<<><^<^<<>>>^vv^>^^<<<<vv>v>^^<><><^>>v>v>v>v<><vvv^>>^<>v^<^v^>v^<<><vv^>^^vvv<<<<v>^<vv<<>>>v^v^v^<><<v^<^<>><^^vv^v><v^vv<<^^<v^<>v><^><v^<>^^>^<<>vv<^><>^vv>><v>v><><<vv<v>>^><<^^><^>^vv>^v^><>v>v<>^<<v<<>^>><>v^vv>vvv>v>v>v^v^>^<vv>^<<v>^>v<^vvvv<<^^v<^^<>v<>v^>>v^v^<^v>v>><<<^v>v><vvvv<v>^<^<<<><>v>v<<^>><^vvv><<>^<>>vv>^>^<v>>>vv^<v^>><><^vv>v>v<^^><<<<<<v>^v>v>^^<v>v><<v^^v^vv>>><^v<<<v^v<<>><>^v<>>^<^v^^vv>>>^>v>^vv<<vv>^><^<>>vv>>^^<^><^^>><v^vv^<v^>vv<v<vvv>>vv^v<<>v^>><<vv>><^<>v>vv>^<v>^^>>v><<><^<>><><>^^^^v><^>^^<v^<>v>^^<^<v<vv^^^<>>v^vv^>>^^^vv<<>^^>>^v>>>>^><^^<^<v<>>><v<^<^>vv^v>^^^v^>><>vv><v<>^>>^<<v^v^v^^vv^<v>^<
|
||||||
|
><<vv<v^^^<>>>^>v>^<^^^<v<vv<^^<>><^<>><^>><<>v<^>v^><<^><>><<v^>^<<v><^>v>><vv<^v>><>v<<^^v>v><>>><^>v>>^v>>^v<>v>><v^<v<<>>>>^v><<v>^<>>v^^v><>^v<v>>v><^^<vv<<<v><^><><<><^><v^^>v^>>^<<>^v<<^^^v^<<<><^^<><vv<>>^>^>^^>>^><>>v>v><v^>><<v^v<>^v>^^^^<^>>>>vvv>v^v>v>^<>v>v<v>>>^vv<>^><v>^<^<v<<<<>vv^v<v<v^<>^>^^^><>v^^^>v^<>>^vvv^^<>>>^<<<vv>>^v<><^>vv>v^^^<v^>>v>^v>v^>vv>vv>>>vv^vv>>v<>v^vv<v<^><^v^><^vvv^vv<vv^>vvvv<vvv><><>><^<<<^>vv^>>>v<<>v><<^>v^<<<><v<<^^<><<<><<^><>v<><<>v<^v<^^v^^>>><<^vvv<<>>^>><<vv<v<^<<^<^<<<>><<v>^v<>^^^>>>^^<^^^v^^v<<^^v^>v^<<^<>^><>^v>>>^^vvvv>v^<v^<^<v<>><v^^>>v^v^^v^^><v^^^^^^v^v><^<><><<^<vvv^><vv^<<^<v<v<^^^^><>^vvv<v>>>v<v<<v^>v>vv<>^>><<v<v<v^^^>v<<>v<><v>v>><><<v><<^^^v>^vvv>^<^>^v<<>>^><>>v><><^v<v<<^v^<<v^v>v^^<^v>>^v^v>^^^<<<<>v^>>vv<vv<<><>>^^^v^v^^^><><v<><v<<v><<v>vvv>>^^<v>v^^>^><<v<v>>>vv<>^<>^>>v>>^>v>^v>^v>>vv<^<>v>>vv<<v><>^^>><>vv<<><<^>v>>^>><>><<>v><<v>><v^<>v<>>>>v<<v>>v^>^<^>>^<>^v<<vv^<<^v>>v<>v>^>v>>^<>^<vv><^v><>^<<v>^v^^^v>^>v>^^v
|
||||||
|
<v^<^^vvv^v<<^<v^<^vv^v>><>><<><>^v^^v^^^<v>v<^v<v^><v<>vv^<vv<^>^>^^>v<>vv^v^^><^^>>><vv<>><v><^>vv>>><^>v>v<^<<><<<v>v<v<>^>>>>v<^><^v^<>^>^><v>^vv<<^>>^v>^^^>^>v^v<>>^<>vv^^v^^<^<vv>v>^v>>>vv^>><v>vv<>><^<><v><v>^v>>>>^<^^<<>v<^vv><<^^<<v<v<v<<v>v>^vv>>vv<<>><^<^<v<>v<>^<^<<>v^vv>v<>^vvv>^<vv><v>^^vvv^^^>^v<^v^v^<<>^vvv>^>^vv>v^>^><vv^^v>vv<<v^><v>v<>>>>>^^>vv>vvv<vv<<^v<^<^v>^<^><v>^><<^<^<v<vv<><<v>^v><<v>>v^vv<^<<v<^>^>v<vv<^v><v^>^<v<>>v<>>^v^v^><^<<^v<vv><v^^^v<>>><>v<vvv><>^vv<>^><v>^><<<^v>>v^^>^^<^v>><^^>v<^<<>^v>><<v<^>>v<><>vv>vv>^^<v<^^<^<<^^<^^><v^>v>><<^^>v<<<^<v^><<^vv><>>v<><>^>v<^<<^>^>v><>v>^vvv<<<^>^^vv^>v<<v>^^^v<<>v^>v>><>>^v<^^><>><>v<v<vv>v<<>^>>^v^^<vv<^>^^>vvv^>v^>><><^<<>^<^<>v^>>^^^<^^v<vv>^<<<<<^vvv<><>^>>><^v<>^^^^v<^>>v>^v<<>>v^v<^>vvv<v^vvv><^^<>^v>^v>>>>^^<^^<<v><<>>>>>^v><>^><^v<>v>v<^^v^vv^^^<^>v^>^^<<v>^>>>^>^^vv<v<^v^<>v<vv^^vv^<^>v>v<<>>>^><<<^v>v<<vv^<>><v<><<>v^<^vv<>v><<^<>^><vvvv>v><<><^^<>v>>^<>vvvvv<<^^^>><v^<v>><>v><><^>><>^>>^><^<^^^^v^^vv
|
||||||
|
>v^v^^v^>v>^vv<>^<^^vvvv<>^vvv^<^<><v<vv^^>v^^^>^vv>>^^<^<^v^>v^v<^>>v^>^^v>v^<v<^>^>v>^^^<v^v^<v>><v^^^v^>vv^v<>^>>^^<v><^^<><<<v^v><v^v<><^>v^<^<<>>^v><>^^>^^<v^<<><>v<>v<><^<>v<>vv<<^><vv>v>^<>^v^v<v<^^>>^><<v>^<vv^v^^v<^^^v>v<v<vv>>v^>v<^>>^<v<^^>^vv<v^<><>vv><>v<><<>v><v>>>><<<vv>^<<><^>>^vv^>v<^<>v<^^v<v>vv^>v><<v<^^><>><v^<^v^^>>>>>>>v^<v>^>^^<^><^v>^^<<>^^>>^><v>^<vv<^^<<^v>v<^>>vv<^^>vvvv>^^>v>>>^^<<<^<^<^^<^<^v>>^>vv^<v<v^v^<v<><<>v^v^<><<vv>><^<^^v<<vvvv<<<<>>^v><>v^v^<^<^<v^<>vvv^v^>^vv^>^<^><><^v>^v<v>>^v<v^^^v^v^v><v<<v^><<>v<^>^<>v><><>><>v<>v^<v^><v^^<>^^<>v><v>^^>^^v^>v>v<^^<>^>^>v^vvv<>vvv<<^vv<v^^^vvvv^^<<vvvvvv>v<^>>^^vv<^^><<<>v<^^<v><v^>v<^^v><v^<><^<><><^^<<><><<vvv^<<^^><>>v^^<v^^v^>v>vv>^v<^><>vv^^>v<>^v<^^><>^^^><^<<v>v^<<<v<>vv>vv<><^<^<^<^<v>v<v>^v^vv<v<><>v<<^v^^>^>>v>^>v^>^v^<^^^<<<^<<<>^<^v<>v<<vvv<>><<<v^<<>^v<<><vv^<>^vv<^^<<>v<<<^^^<v<v<>v^<^^vvv<<^^^>><^<>v><v<><v<><v^<<vv^^v>>v<v<v><vv<^v><v>v>>v^v^^v><^v><>^v^v^^v^<^^v>><<<vv><^<v^^v>><>^^<v^>^>>><^
|
||||||
|
^v^vv>><^><^>>>v>>>>v<>><<vv<vvv^<><>^^>v<<><><^^>>^><^><><^^^^v<^^<><>>>^^<<<^v>>>><<^^^<>v<v>><<v<v^^v^<^>v<^<v>><>v^>v>>^><vvv^^>^v<><><vv>^<<<^vv^<^vv<v>v>v>^<>>^<<v^^^v^>v^<<<v<^^^^v^v<v>>><<<>v>v^><>^vvv<v<v<<<><>><^v^>>^<><<v^v^>vvv^v>^^^><<^v>^>v>^<<^^v>v>>^<v^^<vvv>^>vv^^><<><v<^^<v><>>>^<>><v<<<^^v^v>v^>v<<<^<^<^<^v^>^^v<^<v<>><<>>v<vv^<^>v<^vvv<^>v><>>>^>vv^^>><^>^<v<><v<v^v<<>^^<^^><>^v>^^v^^vv^<>v><^v<>^v<v^v>><v^^<v^<vv<<<<^><^^^^vvv>^v^>^<><v<^>>v><<v><^^>v<^v<v>>><v><<^v^<v^><<<v<>vv>vv<^^vv^^^v<>vv^<v<vv>^v><v<vv>v<<>^^vv>v^<<^<^^v><>vv<>v<v>vv^<v<^><<<v><^v<><<<v^<>>vv>v<v>^v^>v<<<>v^v<^>^^^^^<v<<<v^<^^^<vv>^><>>>v>v<^<v^^>^><<<^^><><v<v<^v>vv^^^<^<>>>^>^v<>v^><>><v^^v>vv<>^<^vv^<<>><>>v^<>>v>>>>^^<v^v<^<v^v^^>v><>v<v^^v^>v^<^^>^^^vv^v<>vvv>^>^^<v^v<^^v>^^v^<>v<^<vvvvvv>>^v<^^v>^<^^<><<v<>>>vv^v<<^<vv>^^><<<<<>^<^v<<v^v<<<<<vvvv<v<>v><^^<>^<<>^v<>^v><>v<v>><^<>><v<><v^>>^<>vv^<v^v<^vv^<><<<v^<>><^>v>v^>v>v^>>^^^>>^>v<<^<>v<>^^v>>>>>v^>v<<^^^^<^^^v<>^>^^v^<<><>><>^<v>v
|
||||||
|
v>v^^^^><v^v<vv>v>vv^v>v><>^>v<^><^>>v<>v<<<<v^v^^^^<<<<v^>^<v<v>><v>><^>v><<v><v>^vv^<vvv^^<<<>^<^<v^v>^^<^>v>>vv^vvv<v^><^^v><v<<^<^^<<^^><>>^vvv^<^<>v^>>^v><v<^^<v^<v>v^>^^<<v^<>^<<^<vv^^v<<^v<^vv><^^^v>^vv^v>v>^><^>^^^^<>^^^>v>>v<^v^v>>v>^<<>^<^^<>v^<><<^>^v^v^v^>v<<^vvvv^<<^^<^<^vv>^v>v<^<><v>^><^<><v<<<>>v^<<^<^^^^v>v^<^>v^>>^v^<>v>^v<>>>v>^>^^>>v>>>^^^^><^v<^>vv^>v<>>>v^v^vv^<>^><><^<>^<><vv<v^v>v<^v><>^<<v>>vv<><vvvv>vvvv<^v<<<>vv^<^<^v^<>v^v<v^<<>^v^<vv>>v>><vvv<^>>v^^v>vv^vv<v^<v^v>^^>vv^^>^<>^<^><><<>^>^^<<<>^v>v^<>v^>>><<>>^<>v<<v<^v<v>vvvvv><<<v<^<<>>v^>v^^<^v><^>vv^>vv^<><<>vv>vv^<>^^v^v<vv<>v>^<><^<<>^v<v<^^<>^<>>^<<>^^^<<v>^>><v<^^<><v><><v<v>^>v^<vv<<>>^v<>>^>v^v^>^vvv^><<v<<v<^<v<<><^^^^<<^^<<^<v>^>^>^<>>>^^>v<<^<>v<^<^<>><>v^>v>>>^^^v<^^><^><>v<v>>v^^vv>^v<v<^<^<^>^v>>^<^vv>^^<^^^<^>^<^<v^^<><v^><v^v<v<<^v^<>v>v^^v>^vvv^<^^v<^<>vv<v<v<^v<><^v<>v^><<^vv<v^<<<v<<v<vv<^v<>>^^<v<v>^v<<>v<^^<>v<^^^^<vv^^v<^><<v^>>^<<^<<<<><>>^v<<<>^><<^>vvv^v<^v<v^vv<vv^<>^^<^^^<<^<^<><<v
|
||||||
|
>vv^>^vv^<>^>>>^<^<vv<v><>>v>^>>v^<><<<^vv^<v^^v^vvv><<^>>v<^v>><^><vvv^>^v^<><<v<^>>^<>^v><v>^<>><><<<^>^<v^<<v<>><^^v><>^<><<<<v<^>>>v>v>v^v<^<^v>^>^><vv<>>><><^v>^v>>v^^>^<v<><^>>>vv>^v>^<>>v><^>^>^v>v<>^>vvv<>>^>vv>^v<><<<<v>>>v<<v^v^<v^vvv>><>^^<vv<^>v>vv<<^^<>^^v^>vv^>>v><><v><^><><v><<^><<^v^>><><><><^^^vv>vvv>v<>>v<><>^<><vv^v<^^>v>><>^>^>^^^v^>v>><><v^vv^>^^<^vvvvv^^<vv^<<v^v<<^^^<<v^^><^v<^>>>^v>v<<<^^><<v<>^vvv^<>^^<^^^v^<^v<<>>^v<<^^^vvv<v><vv><<vvvvv^^vv>><<^><<vv^><<v^v^>^^<>>v^<<>vv>v^v>><^<^>^^<><<v>^^^v<^<<^v>>^>vv^<<>>^v<>v^><<v^vvvv^^<<vv^<><^^^<>v>>^><<^vv><^><<v><<<<v>v^v<^^<v^v^>>><^v<^><<v^vv^^>v>v><>v^<v^<^<<v^^<<^^<>><v^<>^><<>><<>v>><<>^>>^v<^<^>vv<<<^<v>^v<^<v^^>v>>v<v^<<<v^<^v>v^v<^><vv^v<<<<^v>^<>^<<^>v<vv<<^><v<>^>^>v^<<^^v<<^>^>>>v^^^>>v><vvv<^vvv<><^>^>^v^<<^<^v>v^^<><vv^^><^v<<vv^^^<v^vv<<>><<<^<>><v<v<v<<^<<v>>><^vv^v><v^v<<<>v^^><>^<v<vv^^<<^<>v>v<^<vv>^>^v><v>^<^<<^<^^v<v^^v<^><v<<vv>vv<vv<<<vvvv><>^^v>vv>^<<^vvv>vvv<^^<^<<>v^v<v<>^vv><<>^>v>>^<vvv^>
|
||||||
|
vvvv^v^^>^>v^<>><<>>^>>>v<><>v<v>v>v><<<^^<>^^v^^^<>vv<v^^<<^v>>^vv^><^^>>>>^^^<<^<<>^>>vv^<>^^^>>vv<>>>^v>v^^<>>>>^^vv>^><^^vvv<^>^^>v>^<<^^><><>>v<>>^<v>>><^<<v>vv>v><^v^^v<<vv>^<v><<>vvv^>^>^<<^>>>^v^><>^^^v<<^v^>>v>v><>vv^v><vvv>vv^<<v<<^^<v<vv<<v>v<^^>>v>>v><>><>v><>v>vv<^^v><v<vv^v<>v<v<<v><<<<<>><>>v^>^^<^<<v<^^^>>^>>v>>>^v>v>^><<<^^>v>^<v^><v>v<>>^<<>^<>v<<^^<<<^<>><^<>v<>vvv<v<<><v^<v<>^><^^<^<^>>>v^>v^>v<v<v<^><>v<>v>^v>v<>><^<^<<><<^<<<>vvv>>>^^^<<vvv>^>^<v<>v^v<<^vvv><>>v>v><vv^vv^^<>^<>v>>^^<<>>><^>><v^<vvvv^>v<^v<<<><>vv^v^>^v>>>^v^<<v<>^>>^>>v>^vvv^v^^<<^^<>vvvvvv>>>v^>>>^vv>^v<<><><v<<^<>vv^^v^<^vv<<<><^v^vvv>v<>>vv>>vv<v<^^<vv<v^<<>vv^v^<<>><^v^^^>^v<<^><>^>><>v>^^<v^><v^>vvv^<>vv<<^^>><^<v<v<>vv>v<v^v<><vv^<<<>v><v>^>^>^<^v>^<^v<^>^^<v^<<<>^<^^v><>v<<^vv><<><vv<v<vv>v^v^v>>v>v>>^^><v<^v^<v>v<>vv^<<v><>><vv>>v<>^>^vv><>^^>v<<^v<v<v>>vv^>><<<v^<><<<^^><<^v^v^<^^<>v^>>>><>^<vv<v>^<v<<^>v^>vv<<<<v><v<v^>>^>v<vv^>vv<^^>^v>>^^^v>>^^v>>^>^<v<^<<<^<v><^>^^<v^>^>><>>>^v>>^<^<^
|
||||||
|
>><>>>v^><^>>>^<^>v^<^^<><^<^>v<><^><^>v^<><<v>>>>>^>vvv<^><>^>vv>>^^<v<<v^^>>>>^<>><v^>>^v^^^^^>>><<<<>>v<^^v><>>vv^>>vv^v^v<^<^<>>v><>v^^>v><>v>^^<^v<^>>>>>vv<v^vv^<><^^^v^vv>v><<^<v<vv^v>vv^^<^vv<v<v<<<>v<>>vv<><<>v><^<<vv^^v^^<v^v<vv>><^<><^>v<^<><><<^<><^v^<^^v<^<vv^>^<^vv^v>^<^<^<>v^v^<v<v^><><>v>>v<><v<^v^^<<<^>^^^<v><>><><>>>v^>>^>vv>>^vvv^^><^<<<>^^v^v^>v>^v><>^^vvv<^<^^><v^>^>>>^vv^><v<<<<^><<>v>><v<>>v<>^^^>><<<<v^<>^>^v^^<<v^>^^<v<>^v^<>^^<>><<^v<<^>^v>>^><^^<^>^^<<^^<<v<v^<vv^v>^>v^><>>^^^vv><^>>>>>^^v>^<>^<<^^v^^>>v^<<><^v<^v^v>v>v<><^vv<vv>v^^^<v<^^<^<^<^<>^^^<vv^<>v<><<><<v<v<<>v^>>v<>^<^^^^^><<<^>v<v><><>><^<<^^>^>>vvv^><>>><^>>vvv^^>><>^>>vv>v><^>^<v<v<^v^>vv>>v^v>vvvv^^^>vv<<<v>><v<v<>^>v<v^v<><v<>vv^^<vv><^^^v>^v>>v>^v><v<^<<v>vv>vv><<>>>><^v<<^>v>>^<vv^<v<^<v>v>vv^v^v>>>v><<^v^v^v>vvv<>>>>v>v^<<<<^^>^^>v^vv><v^v<vv<^<^^>>v^v><<><v><vv<<vv<v>^<>v^>>v^v>>>>^<>><>v^<^>v^<^<>>^vv<><v<<^v><>^>^<^v>><v^<>v><^v^>^^>v^>^vvv^<<>v^^^>>^<<<v<^v^^><^v^>vv>^vv^v^<>^>vv>vv>>>^>v
|
||||||
|
^^^^^>>><<^v><v>>v^>^<^>>>>v^>v>vv<>><^^^v^>^^^v<<><^v^^<^<<^<v<v<v>>v^><v^>^^^^><><<<^vv><<v^^>^v^<>v>^>^>>v>v^v^<>^v^>v^<v><>^<v>v><v^^>^><v^v<>^<v><>^>><vv>^v<>><v^v^v>vv^^<vv>^<^>><^v^^^vv>v>v<<^v>>>^^>v^>^<><^^>^<<v<v>^<<><v><>^^<<>vv>^>vv^vvv>><>>v<>>^vvv><>^^<vvv<<>>><^<v<v<<^>><<<>v^>^<v<>^^<^^<>vvv^v<^^vv<^^^>vv>>v<>v^v<<<>v>>^>v><vv>v^<vv><><>v>>vvvv^>v^v^vv>vv>^>^^<v^^>vv^^v>>^><>>>v<<<>^>^vvv^v^v><>v^^^>^>>v^><><v<^v>v>v>v>vv><<<><<^<>^vvv<<^<><v>vv>^^<<><^v>v>v>v>^vvv<>^v<v^<^^^>>vv^>v<^<<>^<>vv<v<^<vv><v^>^<^>^vv>^^>^>>>>>^vvv>^<<<v^v^v<<>v>^>>>^^<^>vvv>^v>^<v>v>>v><<^<>><^<^^^<>^<v^<><v^vv>^^><^^^<>><v<^>><v^^^v<<>><>><>><>>^^v<>>v><<v^<^^<vv^v^v<v^<v^v><<^v^>v>><v^><v<><^v>^<v^<<^>>^>vv>>v<><>v<v<<>><vvv><^>vv><v^v^^^<>v>v<^v^v<v>v<v>^^>v><><<v>>^>v<vv<>>^v>><^v^>><<>^>>v^v<>vv>^^^>^^vv^<^>v^^^>^<<vv<<^>^>^><>vv<^vv<^^<v<v<><<^v><^>>><^>^v>^v<<^^<<>^<v^v>^v<>>>^>v>v<vv^<v^vv<>>>^vv>><vv>^<vv^^>^^>>>vv>v>v^v>^vv<><>^<>>v<^^<>>v^>>>v>^>>^>v<<<>v^<^vvvv>v>^<v>^<^vv>>><vv^v
|
||||||
|
<^><>v><><>^vv^^v^<^<>>^>>v<><<<^>>^<vvvv<>vvv><>v>^>^<^^v<>^<<v^v>vv<v>v<<^v^<>>v>v>^>v>^^v^v^^<^v>^v<<><^v<<<<><<^><^>^v^^vv><>^^vvv<vvv>^>v^v^<>vv>v>^^^v>v>^<<vv^v<>^<^<vvvv^<>v><v^<<<>>vvv^>^^>>v<<v>^^<^v<<v>>v<>><>>^><v<v>>^><^<v^vvv^^>>>>>^>>>vv<v>^>v>>^<<>>v^v^^vv^>v<<><^><v><>^^<>^vvv^v<<^<^v<<><><v>v>>^>v><v>^>v<v^<v>><vv><><><v^v^^>^v<v>>>vv<^><<<v<^v^><<v><<v<^^v>>>vvv^>vv^<v^^><v^<<>v<v>^<>vvv<<^><<>^<^><^><><>>v><>>^vv<^^^^vvv<^v>>v>^<>>>^vv<>^^v<^v<<^><v^^^v<vvvvv><<vvv>v<<v><v<<v<vvv<<^>v^^v^>>^v^<^<vv^v<vvv^<<<><>>^>v>^v<^<>vv>>^><v^>^<<><^>^>><^<><^>v>^^^><v^<><v<v>^<><>>^^>^vv<v^>><>^>>><><>^<<<<v^<<^<v^>^<v<v^^<v<<<v>v<><v^<<^>^^>^>^><^vv>v>>v><v^v<^^v>>v<<>v<^^>v>vv^<v^^<v><v^^<vv<^<v><<vv^v>>^><vv<<><^>^>>v^vv><><^^<<>^^^<>^>>>^v^<>v<<v><vvv<^>v>^<>v^^<^^<v<^^<^v^<><<^<^^<vv^<<<v^><v><<><>><<<v>>v^>><vv<vv^<^>v>v>vvv><^<^v^^<>^<<>>><<^>>vv>v<v<v>vv>>>v^v><<v<>vv^>v<>>v^^<v^v^><^^^<^<>^><<<v^>^>^<>v>vv<<>^v>^<<><^^vv<v>>vvv>>^<<^>^vv<^>>>vv^<^<vv>v<v<<^>vv^<^v>>v>v^
|
||||||
|
^<^><v<<>v>v<<^<>^>>v^>>>vv<>v^^<vvv><<v^<<<v>>>vvvv><v<^<<^<>^vv<v^vv>>^^^v^<vv<<v^<>vv^<^vv<<>^^><v<vvvv<<>>v<^<<>^><<><<v<><<v>^><^v^v>v>v<>^vv^v<>>>^v^^>v^>v^v<vv^^>v^><^^^^>>v<vv<^>v>>^^><^<^>>v><v<><<<<v^<>^>><v>>>v^>>v>v^>v<vvv<^^>v<>^<^<^v^^v><^>>v<<v<<<<>v<^^vv>^vv>^^v<>^><>v<<v^<>v>><<^^<v>>^^<<<^v<v<<v^<<v<^v><>^<vv<<>><<v^^^<v>>^<v<^>^>v^>^>vv<v>^v<<>vv<^vv^<<<vv<<><v^^v>^^vvv^v>^<vv>><><<<<v^v^<v^v^>^vvv^v^<<>^>^<<<<^><><>>vv<>^v^<>>vv<>^^><>vv>v>vv><><^<<^<^vv>>v>>^<^^v<v>^^<v<^v<v<vvv>^><>v>v^v>>>vv^<^^^v^<^^>vv>^vvv^v^^v<vv^^<^^v><^v<<<^>v>vv^>^^<^<>vv>^<v^>vvv>^<>>>>vvvvv^^^<^v^>>>v<v>>>v^>^^<<><<v><v^>>^<^vv>^<<v^v^v>v>v<vv<<^<^^^<><^^><>v>^>v<^<^^^^^<^^^>^vv<>>>v><><>v<<<>v>vv><v><><^>^<<v^<^vv<>v^><^vv^^<<>v<<<>v><<>^<^>^^^><<v^>><<<vv^^v>^^<^^vv<<<vvvv^><v>>>v<<<<>^^<<<<>v^<<>^<v^v^>v><v<v><><<>>^^<>^v>^v>>vv^<<<v<><<^v>><v>><<>>^>vv>v>v>>v<>>^><><<><<<><>v<>>^^vv<>^<<<^^><>><v^<v<^>^<v<^^<<<>v>><^<<>v<v^>>^^>^^vv^<^>^^^v^^<v<<<^<vv^<<>>vv>vvv>^>v^vv<><^><>v^^<>vv<
|
||||||
|
^v^v>v^><^<<vv^<>^vv^v>>^>v>v^vvv>^>^v<<<<>^<v>>>v^vv>v>>^vv^<><<^><>v>>>v>v>^>v^vvv>^>^^<<<<^<vv^<v<<><>^^v^>vvv>>>^<>>^v<>^^>>>^<<>^>v>>>v<<><v>><<v<<<vv^<><v<^v>>>^vv>>>^>^^<>v^vvv<>vv<v<^<^vv<^^>>>v>v^^^v><^>>vv>>v<<vv^>v>^><<v>^vv^v<><v>^v>vvv^<<<^^>>>>^^v^vv><<<<<<<><^^v^^<v^v^>^^v^^v<>><v^>>v>>v<^^vv>^<^<<v>^<v<<v<>>vv<^<vvv<^v^<v><^<><<<^>>>><>^^v>v<^v<^<vvvv^^<v<^<v<^<>vvv>><<<vv^<vv><vv^v<><<>^v^<^<<v>^>>><^>^^>^<^>^vv^^<>v<^>v^^^^^><<<vv><>v<^v^<>v^>^><>v<<^v>>>^v<^v<^<^vvv>vv<>^v^>>^v^v>vv<v>>v>v^v^>>v>><><v^v<^>vv<<vvv^^<<vv^^<^v^<>v>^<<^>^<<<>v><^<<v>><^vv>^>>vv^vv^<^^^<^v>vvv<v<^v^<>^>>>^v<<<>v^^<^v<>^^^<^v^<>>>v<^<<^vv<>v>^^<v^><<vv<^v<<^v<v<v^<v<<^<<v<^>>>v><>^<><<^^^<^>^>vv<^vvv^><v^v>^^<v^<>^<^<^<<<^v>^^<v<vv>vvvv^<<<>^<^>v^^>^>>vv>^v^><>>^<<^^v>>v<^v>v>^^^>v^^>^>>>>><^^>>v^>^v<>><<vv^^v<^>v^v^vv><<>v^><<>v^>^^^vvvvv^^^>^^>v<>>>^><^v^<^>v><>>>>>vv^^<^v<<<<<<v^^^<^>v<^><><<^v^^<v><<<v>>^^<<v<>v<<>>v>v<<>v^v>vv<>>^><^<>v<v<<^>v^<v<^^^v>^<<v>>vv>>v^<<><<<<<^<<>vv^><^^>>
|
||||||
|
<><>^v^^^<vv><<^>^><^<><<v>^<v<>><v><<v>>vv^<^^^<v<^v>^^<^>v<v>v^v^<^><>>^>^^^v>^v^>>><v>^^^^vv<>v>>>^v<<<v<<v<^<v^v>>^>>>>vv><><^^<><vv<^v<vv<v<vv<vv>v<>v<^v>>^>v<><v>^^v^^>^^<<^><<v<<<<v<v><^^v^<^<<<>v>v^<^v<>>^>vv<^>^<>v>v^<^vv^<>>^^v>><vv^<>v>^<<<><^<>v<<v<<>^>><vv>^>v^><<v^>>vvv^v>>>^^<v<<v<v<^>^vv^v>>^^v^>vv>^>>v<>v<>v>><^<v^v>^<^^v<<>v<vv><vv^^>>v>v>v<><^v^v<<>^v>>>><v<>vv^><<>v<v^>>v^^v><<^<vvv^><<^><v<^^v^>^>v<>^<<^><^<>><>>v^<>^v^^<^<>>>><<<v>^^^vvv<<vv>v^<vv^^<^<v><v<vvvvvv>>vvvv^<v<^^>v<>><^<v^>^<^<^<>v<>^>v<>^^>v^^>vv>><v>^>^v^<>vv>>>^>vvv>^<>^<^<>^>v^v^<vv<>vv^<>^<v>><>^^>>vv^<><vv^^v><^>^^vv<>^<<<<vv<<vv^<v<v>^vv><^<<><v<vv^<<v<><>^>v<^^vvv^<^v>v^>>>^<v><^v<<v>^v<vvv>^^<^^vv>>v^^>v<<^>v>><^<v><v^>^>v^^<<v^vv^^vv>^^^<<<v><<<^<^v<v<^>v<^>>v^<<^<^>^v><<<>>>>>><>v^v^><>v^><^^^v>>v^v<<^v^<vv<>>^^<v^vv>v<^<v>>^<<<>><^<>^v>>><>>>^>>^v<<vvv^<<^<v>>^v>vvv<^^^^vv>v<>><>^<<><<vvv>^<^<^v>><>v<^>v^>v>v<<<>vv<>^v^^>>>>^<<>v><>>>^v^>^><<<>v<>><^>>^^<vv^^>^<^vv>>v<v>vv<<><^><<^v<>^v<<v<
|
||||||
|
v>^><v^^vvv>>>^<<<>v<v^v>>v>^<^>v^<<^>>^^<^vv>>>><>^><^^^vv><v<^^<<^<<>v^><<v<<v><>v>v<>^>>v^<<^>^<<v>^><^^v<<^>>vv>^^^^^v<^>>>v^v<^v>>>^^>v^<><<vvvv<^<v^>^<><^v^vvvvv^^<<>><<>>v^vv<^v<>>^<<vv<vv>^<<v>^^>v>>^<>><v>>v^v>v>^><<<>>>><<<<<v>^v>>>>^vv<<<^>^>vv><v^v^^vv^v^<v^<^>v><><v>><^^<^>>v^^<^><^<<v<<v>^v>vv^<^><<>v^>><>>v<^>^><vvv<>vv<<vv>^v>v<<^>^<v><<<<>^<^^v<vv<>>><^vv^v<<<>^^v<<><v^v^v>^<v>v^<<v^><v<<^v^^>v^^^^<>^<<>v<>>^>vvv<^^v><^><<vv<<^<<vvv^<>^^<<>v^<^^<<<>^v^<^<><v>v<^v>v<^v>^^<<^^><<<v<^<v>^<<^^><^>><^^<v>v<^^<vv<<>>^v^>^<^<^>v>>^<^>v>vv^<v>vv>vv<<<<<<<<v^<^<v<^<^v<>^<v>^v>^>vv<<^^<v><v<^<v<^>vv>v>^^v^v<>>^^>>>v<^^>><>>vvv^v^<>>vv^<>v^v^v<^>>^>><^><^<v^^vv<<><<<v<^v^vv<<<>vvv>^v^<>><v<v<<<^^^^v^>^><>^v^v>vv^v><^>^<vv^>vv<^<^>>vv<^^^><v^v^>^>v>><<v^v>vvvv^<>v<^>^vv^^^v^<^^v>v>^v>v>>^<v^>v>>>v^^<^v><<<>v<v^v<v^v<vv<<>vv^^<>vvv<><>^<v^>^v<^<^>v>^vv><>vvv^<>><<^v<>^^^<<<vvv^^>^vv<<^>><^v><>vv>vv<^<vv<^v><^>vvv<<^>^^<<^<^>v<^><^^v^^<v<<v>^v<^v>^^<<^^<>v^v^v^<^v^>>><>v^v^v^<<^<><v
|
||||||
|
<vv>^<v<<^<v>^^v><>vvvvvvvvv<vv<^v<>v<v><v>^><v<^^v^<^^v^v><v^^^<<<vvv<v^^^><><<<>><^><^vv<<><<^vv<>^v^<>>v>^vv^>v>v<^vvv^><<vv<vvv<v^^>v^v>v>v><v^><v^<^v<v^>>^<>v<>>^<^<^^><vv^^^>>v^^><<>^<^v^^vv^<<vv^<>><v^v^<^^v^v^>>^^<>v<^v>v>v<vvv>^^v<><>>vv>v<v>><^v>^>^>v<^<>^v<<vvv^v>^v>^^>>>vv<>v><vv>>>>^>>v^<<v^v<>v><><^^v>v<v^<vv^>>><<>>>vvv<>^<<v<<<<vv<>>>vv><^vv>><<v>><^v>^<<^v^vvv^v^>^>^v<v^<>v>><v<^v^>><>>>vv^>^>v<^><^^>>><^^v^<>v^^<^>>^<vv^>>v><^^>^^>^^v^>>v^<>^^<<<>><><>>^>^<>^><^><<^>><v>>vvvv^^^vv<><<>>^v<<<<>^^v><^v<<v>vv>>v<><>^^^>^<>v>>v^v<v<>^<<^>v^vv>^^v>v<>^>vvv^^v>^^v<^<>^v><<v^v^<>^^><^vv<<>>>^>v^>^>>><<<v^<<v<<<^v><^^>^v^^>v^^v<^v<>^>^<v<>><^>>>^>><<v^^<<<^><<<v><^>><^>>><v<>^><^vv<^>v>vvv^<^><^v<<<^v^^vv<^<v<>^vvv<>v>^<^><>>>^v^v^^>^^<<>>>^<>>^>^><><><^^<^^^<>>^<^>^><<vv>^<v><^>^^v><>>^>^>v^v<<<v<>v^<><^>v>v>v<>^^>vv^><v>>^v^<>^^>v<><><^<>><^><^v<<<<v^vv><^^v<<^v<v<<<v^<vv^<<<vv>v<<<>vvv<^^<<vv^>^<^vvv^^v^<>v>v^>><>^v>><v^^^><^^<<>^<>^<v>v^<<vv>><<^>><>^v>>>^v^vvv<v^vv^>^>v<
|
||||||
|
^>v^^<>^>v^^<>^<<v<><v^>^><<^<>^vv^vvv>>v^vv<<^^>^v<v^<vv>>^^^^vvv>>^^<>^v><<^^>>^><^<^>^v>^v<>^v<<v<<v>^><<v<v^vvv>v<v<<^^>>>^vv^vvv>vv<>^>v<vvv<^^vv>^v^><v^>vv><>><^>^^>^v^^<<^vvvv<v^v>>^>><^>>^<<v^>v>^v><v<<<v>>v<^<>^^^^vv>v>><>><v><><vv<<v<<^<^<^<^v<v^^>>>^<^<v^>>^v<><^<>^<vv<^<v<v^>>vv^>>>v<v^<^v^v^^>v><>^^v<<^^><^^>v^>v^^>>v^^<vv<v^>>^v>><>v>>>^v<<>^vv<^^>>>><v<>^>vvv>^v^>v^>^^<^>>>>>v^^<<>v>v<<>>>><>v<<>>>v^v<><>><<>^vvv<^^^>^v<^<v<^<><<<><^^<<>>v^^<v>^vv<^^v^^^>v^<><<^^v^^v<<<>v>^^^<>v<v<^>>>v^^>^v^^v>^^^v<>^^^>>v^^>>^v^<v<<>>><>><^>^><^v<<<^<<vvv^>>vv<v<vv^><>>^>^^v>v<^v>^^><>>v>>v>v>^^<>^vv<^v^vv^>vv>v<^v>><^v>vv^^>^vv<v<^>v<^v<<<^>^^>^<>>^<v<^>^<^>>v<vv^^<^<>^v<^v^<>>^^v^vv^>v<v^<<vv^<><^v><><^^<v^v<v^><<<>><><<^<^^^vv^v<v<><vvvv<>v<>vv^v^v>v<^v><^>v<<v>><^v<v<<^v<><^^^^v>v^v>v<^^^v^>v<vv>v<<vvv^<^v^<^>><<v<^v<><v<<vv^<>v<v<<>>v>v>>v^^v<<^v>><^<<<><>^^v^^<v<><>^<vv<>v<^<><>>v>v<^<^>><v<<><<>>>^v>^<v>><^>^v^vv<<^>^^v<^v<^^<<>^^vvv<>v<v<>>><v^^v^^v^^>^^<^^>v>^^<<>^>^^^><v>v>v>
|
||||||
|
v>v^vvvv^<<<>v<v>v><<<vv<>^>>v<><<<vvv>v>v^^<<<v<^v<<v<>v>v<^v>v^^><^<^^>><^^><^^^><^^v^v^<>>^<^v^^^>^<>^>v<<<vvv^<<^>><<>^<><<v^^<<<vvv><^v>vv<^>v>v>^vv>^<vvv<<v>v<<<>v<>vvv<v^^v<><v<v^v>>v^<<^v>^v^^>>v<>^<<>v>><^^^><^<<><v>><>^^>>^vv^<^^<v^^><<^v^^v<>v<>vv>v^>^>^>^<><><^^<^v>^><^^v^>v>>>^<^^^>vv^^>^>^^<vv><^><><^<<>^v<^<v^<^<v<v<^v<<<>vvv^>^^<><^^<<v>><^>v<^^^>v<v^><v>>>>^v<v>><^v<>v><^^vv^^<v<v<v<v>^<^v>vv><v>^<^<v^v>^<<><^<^v<>vv<<v>v>^<v<<^v<<^<<>^<<v<^>vvv^>^>v<>>^<v^^<^<>v>>v<>^v>>v<v^<>^>>^<^<v^vv>v>>v>>>v>^<<><^<>><><><vv>^<<<<v<<<v^^>^<^<vv>v<>^^>v^^<>v>><^>><vv<vv>>v<vv^v><<<<^>^<<<>><v>>^^^>^>^^v>>>^<<v^v><<^v><>v>^>>>>v^^^<^v>v^>>>^<>^<vv<>v^<><>>>^>^>^^^^<<<>>v><^^<<^><>vv>^<>^<><^vv<^>>vv^^>v^vv<v^<^^^^vv>vv>vv^vv^^^vvv^<>^v^<vv<><^^<<><>v^<^^^<v^<<>>^><<v<^v^><<^>v>>v^<v>^<>>>^v>^<<<v^^v<^>vv^^v<^v^vv>><>><^>^^>v>^^v^<^^v^^><>v<<<v>^>vv^><>v^v^><<>^^<v^<><v><v><>^v><>v><^^v^<v>^><<v>v<v>>>^v><<>^>^^>>v<v<v<vv<<<^>><^<vv<^v>^vvv>>v>>^<<>><v<^>vvv^v^^v><v<><<v<v>v^v^v<<v^
|
||||||
|
>>^v<v^v><>^^>v<>>v<v^^<vv>^v^>v<v^>>^>><^v>^^>^<^v<>v>>^>v<v>v><vvv^><vv^^^<v>>>>^<><v<^<>v>^v<^v^vv<>^<v>^vvv^>^><v<^v^<<<^^^>>>^<<^v^vv^>>^v^v^^<^v><<v<>^v<v>vv<v^vvv^<<>vvvv<^^v<^<vv<><v<^<>v^^<<>v<<>v^^<<><<<<>v^>^v<^^^<^^<^<^^><>>^<v>^^<^vv<>v>>^^^<>><^<^^v<vv><v^<><<^v><><<^v^>^>^^^<^^><vvv>^>v^<^v>v^>v<v<v^>><<v^^><^v^<<vvv^<>vv>^v<><v>>><>^v<v>^<<<v<>v>v>^<<<^^v<>>v<>v<>v<>v>^<^v><^^v<<^^>v><<<<>^^<vvv>>^^><<v<>><<v><^v^^vv><vv^>^^><v<>^v>^>vv>^<^><>^<v>v>><<^><>>>v^v>>^>v^><^<v<<><<>^vvv<v<<^>vv>v^<><<v^^<v<^<<><v<<>>^><v><>^^^^<v^v<^><>^<^<^<v><<v>v<^v>v<>><>>vv<v^>>v<^<<^^>^<<^^^^<v<v>^v^<^^v^vvv><<v>>>v<<v^><<^>>v>>v<<^^>>v^v><<<^>^^<vv<^^^<<vv>>^vv>>^<vv><<v>vvvv<<<<>vv>^<>>v<^<v>^<v^>><^<^>^vv^<vv><<<<<<<<>v>>>^v<>>^>^<^^><v>vv^v>^<^^<<<v^>^>^^v><vv^^<><v>><<^<<>v<vv^v<vvv<<v<^<^^v>^v<^^<v^>vv<>vv>>^>v<<>^vv^<>>^>vvv<>^^^v^<v^><>>vv^vv^^>>v^v<^^<>>v<>v>>>^<vv>^<><<>v<><>vv^v^v>^<<v^<^>><vv^v>vv>v>>>>^^^vv<^>v>vv^<<><>^^><^<<^>vv^>^^<<>><<><>^>^^<>>v^v<v^v^vvv><^v^^v<>vvv
|
||||||
|
|||||||
@@ -0,0 +1,141 @@
|
|||||||
|
#############################################################################################################################################
|
||||||
|
#.................#.................#.............#.......#...................#.......#.............................#...#.......#.........#E#
|
||||||
|
#.#.###############.#####.#####.###.#.#########.###.#.###.#.#################.#.#####.#.#.#####.#################.#.###.#.###.#.#.#.#.###.#.#
|
||||||
|
#.#.#.....#.........#...#.#...#.#.#.#.........#.....#.#...#.....#...#.........#.#.......#.#.....#.....#.#.........#...#.......#.#.#.#...#.#.#
|
||||||
|
###.#.###.#.#########.#.###.#.#.#.#.###.#############.#.###.###.#.###.#########.#.#####.#.#######.###.#.#.#######.###.#######.#.#.#.#.#.#.#.#
|
||||||
|
#...#...#...#...#...#.#.#...#...#.....#.#...#.........#...#...#.#.#...#.......#.#...#.....#.......#...#.#.#.#.......#.#...#...#.#.#.#.#...#.#
|
||||||
|
#.#####.#####.###.#.#.#.#.###.#######.###.#.#.###########.#####.#.#.###.#####.#.###.#.#.###.#######.###.#.#.#.###.###.#.#.#.#.#.#.#.#####.#.#
|
||||||
|
#.......#...#...#.#.#.#...#...#...#.................................#...#...#...#...#.#.#.....#.............#...#.....#.#...#.#...#.....#...#
|
||||||
|
#.#######.#.#.#.#.#.#.#######.#.#.#.###.###.#.#.#.#####.###.#.###.#.#.#####.###.#.###.#.#.###.#.#.#.#.###.#####.#.#####.#####.###.#####.#.###
|
||||||
|
#.#.....#.....#.#.#...#.....#.#.#.#.....#.#.#.#.....#.#...#...#...#.#.....#.....#...#...#.#.....#...#.....#...#.......#.#...#...#.....#.....#
|
||||||
|
#.#.###.#####.#.#.#####.###.#.#.#.#######.#.#.#####.#.#.#######.#.#.#.###.#####.###.###.#.#.#.#############.#.###.###.#.###.#.#.#####.###.#.#
|
||||||
|
#.#...#.....#.#.#.#.....#...#.#.#.....#.....#...#.#...#...#.............#.....#...#...#...#.#.#.....#.....#.#.....#...#...#...#...#...#.....#
|
||||||
|
#.###.#####.###.#.#.#####.#####.#####.#.#####.#.#.#.#####.#.###########.#####.###.###.#####.#.#.###.#.###.#.#####.#.#####.#.#.###.###.#.#.###
|
||||||
|
#.....#.....#...#.#.#.....#.....#.....#.....#.#.#...#.....#.#.........#.....#...#...#.....#.......#.....#...#...#.#.......#.....#...#.#.....#
|
||||||
|
#######.#####.#.#.#.#.#####.#.###.#########.#.#.#.###.###.#.#####.###.#########.#######.#####.#########.#.###.#.#.#########.#.#.###.#######.#
|
||||||
|
#.....#.#.....#.#...#.......#...#.......#.#.#.#.#.#.#.#...#.#...#.#.......#.....#...#...#.....#.......#.#.....#...#.....#.....#...#...#.....#
|
||||||
|
#.###.#.#.###.#.###.#########.#.#####.#.#.#.###.#.#.#.#.###.#.#.#.#######.#.#####.#.#.###.###.#.#####.#.#.###########.#.#.###.#.#.###.#.###.#
|
||||||
|
#.#...#.#.#...#.#.............#.#.......#.#.....#.#.#.#...#...#.#...#.....#.#.....#.#...#.#...#...#...#.#.#.....#.....#.#...#...#...#.......#
|
||||||
|
#.#.###.###.###.###.#########.###.#######.#####.#.#.#.#########.#.#.#.#####.#.#####.#.#.#.#.#####.###.#.#.#.#.###.#.###.#####.#.#####.#.#.#.#
|
||||||
|
#.#.#...#...#.#...#.#.......#...#.#.............#...#.........#.#.#.#.#...#.......#...#.#.#.....#...#.....#.#.#...#...#.......#.#.......#...#
|
||||||
|
#.#.#.###.###.###.#.#####.#####.#.#.#.#############.#########.#.###.#.###.#.#######.#.#.#.#####.###.#########.#.#####.###########.#####.###.#
|
||||||
|
#.#...............#...#...#.....#...#.......#.......#.......#.....#.#...#...#.....#.#...#.#...#...#.........#...#...#.........#.............#
|
||||||
|
#.#.#.#.###.#.#######.#.#.#.###.###.#.#####.#.###########.#######.#.###.#####.###.#######.###.###.#.#######.#.#####.#########.#.###.#####.#.#
|
||||||
|
#.#...#...#.#.#.....#...#.#.#.....#.#...#.#.......#.......#...#.#...#.#.....#.#...#.......#.....#.#.......#.#.....#.......#...#...#...#.#.#.#
|
||||||
|
#.#######.#.#.#.###.#######.#.#####.###.#.#######.#.###.###.#.#.#####.#####.#.#.#.#.#######.#.###.#######.#.#####.#.###.#.#.#####.###.#.#.#.#
|
||||||
|
#.#.......#.#.#...#.......#.#.#.#...#.....#...#.#...#...#...#.#...........#.#.#...#.#...#...#.#...#...#...#.#...#.#.#...#.......#.#.....#.#.#
|
||||||
|
#.#####.###.#.###.#######.#.#.#.#.#########.#.#.#####.###.###.#.###.#.#.#.#.#.#.###.#.#.#.#.###.###.#.#.###.#.#.#.#.#.###.###.###.#.#####.###
|
||||||
|
#.......#.........#.....#...#...#.....#.....#.........#.......#...#...#.#.....#...#.#.#...#.....#...#.#...#.#.#...#.#.#...#...#...#.#...#...#
|
||||||
|
#########.#.#########.#.#.#####.#####.#.#####.#.###.###.###.#####.#####.#########.#.#.#.#.#########.#.#.###.#.#####.#.#.###.#.#.#####.#.###.#
|
||||||
|
#.#.......#...#.......#...#...#.#...#...#...#.#.......#.#.#.....#.#...#...#.......#.#...............#.#.#...#...#.#.#.#.#...#.#.......#.....#
|
||||||
|
#.#.#.#########.#.#########.#.#.#.#######.#.#.#####.###.#.#####.#.#.#####.#.#######.#.###############.#.#.#####.#.#.#.#.#.#.###.###########.#
|
||||||
|
#...#.......#...#.....#.....#...#.......#.#.#.#.........#.#.....#...#.....#.........#...#...........#.#.#.#...#.#.#.#.....#...#.#.......#...#
|
||||||
|
#.#########.#.#######.#.#############.#.#.#.#.#.#########.#.#####.###.#######.#########.#.#########.#.###.#.###.#.#.#.###.###.#.#.#####.###.#
|
||||||
|
#...#.....#...#.#.....#...#...#.....#.#.#.#.#...#.........#.....#.#...#.......#...#.....#.#.#.......#.....#...#.#...#.#.#...#.#.#.#...#...#.#
|
||||||
|
###.###.#######.#.###.###.#.#.#.#.#.#.#.#.#.#####.#######.#####.#.#.###.#####.#.#.#.#####.#.#.###.#########.#.#.#####.#.###.#.#.#.###.###.###
|
||||||
|
#.#...#.#.......#.#.#.#...#.#...#.#.#.#...#.....#...#.#...#...#.#.#.....#.#.....#.#.#...#...#.#.#.#.............#.....#.....#...#...#...#...#
|
||||||
|
#.###.#.#.#####.#.#.#.#.#########.#.###.#####.#####.#.#.#.#.#.#.#.#######.#.#####.#.#.#####.#.#.#.#.#.#####.#.###.###.#############.#.#####.#
|
||||||
|
#.....#.....#...#.#...#...........#.........#...#.....#.#...#.#.#.........#.#.#...#.........#.#...#.#.....#.#.....#...#.............#.#.....#
|
||||||
|
#.#########.#.###.#########################.###.#.#####.#####.#.#########.#.#.#.#####.#.#####.#.###.###.#.#.#######.###.#############.#.#####
|
||||||
|
#.......#.#.#...#.............#.......#.......#.#.#...#.#.......#.....#...#...#...#...#.#.....#...#.....#.#...#...#.#...#...#.........#.....#
|
||||||
|
#######.#.#.###.###########.#.#.#.###.#.#.###.#.#.#.#.#.#.#####.#.###.#######.###.#####.#.#####.#####.###.###.#.###.#.###.#.#.#.#####.#####.#
|
||||||
|
#...#...#.#...#.#.......#...#.#.#.#...#.#.#...#...#.#.#.#...#...#.#.#.#.....#.#.#.....#.#.#.....#.......#...#.#.....#.....#.#.#.#.#...#...#.#
|
||||||
|
#.#.#.###.###.#.#.#.###.#.#####.#.#####.#.#.###.###.#.#.###.#####.#.#.#.###.#.#.#####.#.#.#.#####.#.###.###.#.#.###########.###.#.#.#####.#.#
|
||||||
|
#.#.#.#.#.....#...#...#.#.......#.......#...#...#...#.#...#.....#.#.#...#...#.#...#...#.#.#.#...#.#...#...#.#.#.#.#.......#.................#
|
||||||
|
#.###.#.#.###########.#.#######################.#.###.#.#.#####.#.#.#####.#.#.#.###.###.#.#.#.#.#.###.###.#.#.#.#.#.###.#.#######.#####.#.#.#
|
||||||
|
#...#.#...#...#.....#.#.#.............#.......#.#.#.....#.....#.#...........#...#...#...#.#...#.#...#.#...#.#.#.....#.#.#.#.....#.....#.#.#.#
|
||||||
|
###.#.#####.#.#.#.#.#.#.#######.#####.#.#####.###.#########.#.#.#.###.#####.#.###.###.###.#.#.###.###.#####.#.#####.#.#.###.#.###.#.###.#.#.#
|
||||||
|
#...#.......#.....#.#.#...#.....#...#.#.#...#...#...#.....#...#...#.........#.#...#.....#...#.#...#...#.....#.........#.#...#.....#...#...#.#
|
||||||
|
#.#.#######.#####.#.#.###.#.#######.#.#.###.###.#.#.#.###.#.#######.###.#####.#.###.#######.###.###.###.#####.#########.#.#########.#.###.#.#
|
||||||
|
#.#...#.#.........#...#.#.....#...#.#.#...#.#...#.#.....#.....#.....#...#.....#.#.....#...#.......#.........#.......#...#.#.................#
|
||||||
|
#.###.#.#.#.#####.#####.#.#.#.#.#.#.#.#.#.#.#.#######.###.###.#.###.#####.#####.#.#####.#.###########.#####.#.#####.#.#.#.###.#.###.#######.#
|
||||||
|
#.#.....#...#.#...#.....#.#.#.#.#...#.#.#.#.#.......#.#...#...#.....#.....#...#...#.....#...........#.#...#.#.#...#.#.#.#.................#.#
|
||||||
|
#.###.#.###.#.#.#.#.#.#.#.###.#.###.#.###.#.#####.#.#.#.###.###.#.###.#.###.#######.#####.###.#####.###.#.###.#.#.#.#.#############.#.###.#.#
|
||||||
|
#.....#...#...#.#.#.#.#.......#...#.#.....#.......#.#.#...#.#...#.#...#...........#.#.....#.......#.....#.....#.#.....#...........#.#.#...#.#
|
||||||
|
#.###.###.#.#.#.###.#.#.#######.#.#########.#####.#.#####.#.#.#.###.###.#######.#.#.#######.#####.###.#.#####.#########.#.#####.###.#.#.###.#
|
||||||
|
#.#...#...#.#.#.....#.#.#.......#.#...........#...#.....#.#.#...#...#.#...#...#.#.#.#.......#...#.#.#...#...#.#.........#.....#.#...#.#...#.#
|
||||||
|
###.#.#.###.#.#######.###.#######.#.###.###.#.#.#######.#.###.#.#.###.#.###.#.#.#.#.#.#####.#.###.#.#####.#.#.#.#########.#.#.#.#.#.#####.#.#
|
||||||
|
#...#.#.....#.#.....#.#...#.#.....#.#.#.....#.#.#...#...#...#.#.#.#.....#...#.#.#.#.#.#.........#.#.......#.#.....#.....#.#.#.#.#.#.......#.#
|
||||||
|
#.###.#####.#.#.#####.#.###.#.#####.#.#######.###.#.#.#####.#.#.#.###.###.###.#.#.#.#.#########.#.#######.#.#.###.###.#.#.###.#.#.#.#.###.#.#
|
||||||
|
#.#.........#.#...#...#.....#.....#.#.......#.....#.........#.#.#...#.#...#.#...#.#...#.........#.......#.#.#.#.#...#.#.#...#.#.#.....#...#.#
|
||||||
|
#.#########.#.###.#.#######.#####.#.#######.#######.#########.#.###.#.#.###.#####.#.#.#.#######.#######.#.#.#.#.###.###.###.#.#.###.###.###.#
|
||||||
|
#...#.........#...#.....#...#...#...#.....#...#.........#.....#.#...#.#.#...#.....#.#...#...#.#.......#.#.#...#...#.#...#...#.#.....#.....#.#
|
||||||
|
#.#.#.#####.###.#.###.###.#####.#####.###.#.###.#######.#.#.#####.#####.#.#.#.#####.#####.#.#.#######.#.#####.###.#.#.###.###.###.#.#.#####.#
|
||||||
|
#.#...#.........#.#.....#.#.......#...#...#.#...#.........#.#.....#.....#.#.......#...#...#...#...#...#.#...#.....#...#...#.......#...#.#...#
|
||||||
|
#.#######.#.#####.#.###.#.#.#.###.#.#####.#.#.#####.#######.#.#####.#####.#######.###.#.#.###.#.#.#.###.#.#.#####.###.#.#######.###.###.#.#.#
|
||||||
|
#.........#.....#.#...#...#.#.#.#.#.....#.#.#.#...#.#.......#.#.....#.......#...#...#...#.#...#.#.....#...#.#...#...#.#.......#.#.......#.#.#
|
||||||
|
###########.###.#.#.#########.#.#.#####.#.#.#.#.#.###.#.###.#.###.###.#######.#.###.#####.#####.#####.#####.#.#.#####.#.#.###.###.#######.#.#
|
||||||
|
#.....#.....#.#...#...........#.........#.#.#...#.....#.#...#...#.#.#.#.....#.#.#...#...#.#...#.#...........#.#.......#.#.#.#.....#.......#.#
|
||||||
|
#.###.#.###.#.#######.###################.#.###########.#.#.#.#.#.#.#.#.###.#.#.#####.#.#.#.#.#.#.#.#######.#.#########.#.#.#.#####.###.###.#
|
||||||
|
#.#...#.#.#...........#.....#...#...#.........#.......#...#...#.#.#.#.#...#...#.......#.#...#...#.#.#.......#...#...#...#.#.......#.......#.#
|
||||||
|
###.###.#.#.#####.#####.###.#.#.#.#.#########.#####.#.#######.#.#.#.#.###.#############.#.#######.#.#.#.###.###.#.###.###.#.#####.#######.#.#
|
||||||
|
#.................#...#.#.#.#...#.#.......#.#.#.....#.....#...#...#...#.#...#.........#.#.#.#.....#.#.#.......#.#...#.....#.....#.......#.#.#
|
||||||
|
#.#.#.###.###.###.#.#.#.#.#.#.#.#.#######.#.#.#.###########.#.#.#.#####.###.###.#.#####.#.#.#.#######.#.#.###.#.###.###########.#########.#.#
|
||||||
|
#.#.#...#...#...#.#.#...#.#...#...#.....#...#.#...#.........#.#.#.#...#...#...#.#.#.....#.#.#.........#...#.#...#.........#.....#...........#
|
||||||
|
#.#.###.###.###.###.#####.#########.###.#.#.#.###.#.#.#.#######.#.#.#.###.#.#.#.###.#####.#.###############.#####.#######.#.#.#.#.#####.#.###
|
||||||
|
#.#...#...#...#.#...#.......#.......#...#.#...#...#.#.#...#.....#...#...#.#.#.#.....#.............#...................#.....#.....#.....#...#
|
||||||
|
#.#.#.###.#####.#.###.#.#####.#######.#.#.#.###.###.###.#.#.#########.#.#.#.#.#.#####.#########.#.#.###.###.#####.###.#######.###.#.###.###.#
|
||||||
|
#...#...#...#...#...#.#.......#.#.....#.#.#...#.#...#...#...#...#.....#.#.#.#.#.....#.#.......#.#...#...#.#.....#.#...#.....#...#.#...#.#.#.#
|
||||||
|
#.#.#######.#.#.###.#######.###.#.#######.###.#.#.###.#######.#.#.#####.#.###.#####.###.#####.#.#####.###.#####.#.#.#.#.###.###.#####.#.#.#.#
|
||||||
|
#.#.......#.#.#...#.......#.#...#.......#...#...#.#...#.......#.#.#.....#.....#...#.....#...#.#.......#.....#...#.#.#.#.#.....#...#...#...#.#
|
||||||
|
#.#.#####.#.#.###.#######.#.###.#######.###.#####.#.#######.###.#.#.###########.#.#########.#.#########.###.#.#####.#.#.#####.###.#.#######.#
|
||||||
|
#.#.....#...#.#.........#.#...#.......#...#.......#.......#.#.....#...#.......#.#.#.........#...#.......#.....#.....#.......#...#...#.......#
|
||||||
|
#.#.#.#######.###.#######.###.#.#####.###.#######.#######.#.#########.#####.#.#.#.#.#.#.#######.#.#######.###.#.###########.###.#####.#######
|
||||||
|
#.#.#.#...................#.#...#.....#...#.....#.#...#...#...#.#.....#...#.#.#.#...#.#.#.......#.......#...#.#...#.....#...#.#.......#.....#
|
||||||
|
#.#.#.#.#######.#.#######.#.#####.#####.#.#####.#.###.#.###.#.#.#.#####.#.#.###.#####.#.#.#################.#.#.#.#.#.###.#.#.#########.#.#.#
|
||||||
|
#...#.#.#...#...#.#.#...........#.#.....#.......#...#.#.#...#.#...#.....#...#.....#...#.#.................#...#.#...#...#.#.#.....#.....#.#.#
|
||||||
|
###.#.#.#.#.#.#.#.#.#.#######.###.#.#####.#########.#.#.#.###.#.###.###.###.#.###.#.###.#################.#.#######.###.#.#.#.#.#.#####.#.#.#
|
||||||
|
#...#.....#.#.#.#.#.#.#.....#.....#.....#.#.......#...#.#...#.#...#...#...#.#.#...#...#.#...#...........#.#.#.......#...#.#.#.#.#.........#.#
|
||||||
|
#.###########.###.#.#.#.###.###.#######.#.#.#####.###.#.#.#.#.###.#######.###.#.#.###.#.#.#.#.#######.#.#.#.#.#####.#.###.#.#.#.#####.#.#.#.#
|
||||||
|
#.#...............#.#.#.#.#.........#.#...#.#...#.....#.#.#...#.#.......#.....#.#...#.#.#.#...#.#.....#.#.#...#.......#...#...#...#.#.....#.#
|
||||||
|
#.#.#.#########.###.#.#.#.#####.#.#.#.###.#.#.#.#######.#.#####.#######.#.#######.#.#.#.#.#####.#.#######.###########.#.#####.###.#.#.#.###.#
|
||||||
|
#.#.#.....#...#.#...#...#.....#...#...#.#...#.#.......#...#...........#.#.........#...#.......#.#.......#...........#.#.#...#...#.#...#...#.#
|
||||||
|
#.#######.#.#.#.#.#######.###.#######.#.#####.###.#######.###.#########.#.#.###.###.###.#####.#.#######.#.#.#######.#.#.#.#.#.#.#.#####.#.###
|
||||||
|
#...#.....#.#.#.#.........#...#.....#.....#.....#.............#.........#.......#...#.......#.....#.#...#.#...#...#.#.#...#...#.#.#.....#...#
|
||||||
|
###.#.#####.#.#.###.#####.#####.###.#####.###############.###.#.#######.#####.#.#.###############.#.#.###.#.#.###.#.###########.#.#.###.###.#
|
||||||
|
#.#...#...#.#.#.........#.........#.....#...#...#...#.....#...#.#...#...#.....#.#.............#...#.#.....#.#.#...#.#...........#...#.....#.#
|
||||||
|
#.###.#.#.#.#.#########.#.#.#######.###.###.#.#.#.#.#.#######.#.#.#.#.###.#####.###########.#.#.###.###.###.#.#.###.#.#####.#.###.###.#.#.#.#
|
||||||
|
#.....#.#...#.....#.....#.#.....#...#.....#...#.#.#...#.....#.#.#.#...#...#.....#...........#.#...#.......#.#.#...#.#.#...#.#.#.............#
|
||||||
|
#######.###.#####.#.#####.#####.#.#############.#.#####.###.###.#.#####.#####.#.#.#####.#####.###.#.#####.###.#.#.#.#.#.###.#.#.###.###.#####
|
||||||
|
#.....#.........#...#.........#.#.............#.#.#.....#.#.....#.....#.#.....#.#.#.#.......#.#...#.#...#.#...#.#...#.#...#.#.#...#.#...#...#
|
||||||
|
#.###.#.###.###.#####.#####.#.#.#########.###.#.#.#.#.###.#####.###.#.#.#.#######.#.#.#.#####.#.###.###.#.#.###.#####.#.#.#.#.###.#.#.###.#.#
|
||||||
|
#...............#...#.#...#.#.#.....#.#...#...#...#.........#.....#.#.....#.......#...#.......#.#...#...#...#.#.......#.#.#...#.....#.#...#.#
|
||||||
|
#.#.#.#.#.#.#####.###.#.#.###.#####.#.#.#########.###.#####.#.###.#########.#######.###########.###.#.#.#####.#########.#.###.#######.#.###.#
|
||||||
|
#.#.....#.#...#.......#.#...#.....#.#.#.......#...#.#.....#...#.#...........#.....#.#.........#.....#.#.#.....#...#.....#...........#...#...#
|
||||||
|
#.#####.#.#.#.#.#######.###.#.###.#.#.###.#.#.#.###.#.###.#####.###############.#.#.#.#.#.#.#########.#.###.#.#.#.###########.#####.#.###.#.#
|
||||||
|
#.............#.....#...#...#...#.#...#.#.........#.....#.....#.........#.......#.#.#.#.#.#...........#.....#...#...#.......#.#.....#...#...#
|
||||||
|
#.#.#.#.#.#.#########.###.###.#.#.###.#.#########.###########.#.###.#####.###.#####.#.#.###.###.###################.#.#####.#.#.#####.###.#.#
|
||||||
|
#.#.#.#.#...#.........#.#.#...#.#...#.....#.#...#.........#.......#.....#.#.#.......#.#.......#...#.....#.........#.#.#...#.#.#.#.......#.#.#
|
||||||
|
#.#.#.#.###.#.#####.###.#.#.###.###.#####.#.#.#.#########.#.#.###.#####.#.#.###############.#####.###.#.###.#.#.#.#.#.#.#.#.#.#.#####.#.###.#
|
||||||
|
#.#...#.....#.#.....#...#.#.#.#...#.#...#.#.#.#...#.....#.#.#...#.....#.........#.........#.#.....#...#...#.#.#...#...#.#.#...#.......#.....#
|
||||||
|
#.#####.###.#.#.###.#.###.#.#.###.###.#.#.#.#.###.###.#.#.#.###.#####.#.#######.#####.###.#.#.#####.#####.###.#.#######.#.#####.#####.###.#.#
|
||||||
|
#.#.....#.#.#.#.......#...#.....#.#...#.#...#.#.#...#.#.#.#...........#.#.....#.....#.#...#.#...#...#...#.....#.........#.#.........#...#...#
|
||||||
|
#.###.#.#.#.#.###.#.###.#####.#.#.#.###.###.#.#.###.#.###.###.###.#####.#.#.#######.#.#.#######.###.#.#.#################.###.#.###.#.#.###.#
|
||||||
|
#.....#.#.........#.#...#...#.#...#...#.....#...#...#...........#.#.....#.#.....#...#.#.........#...#.#.....#.....#.....#...#...#...#.#...#.#
|
||||||
|
#######.#.#.#.#.###.#.###.#.#.#.###.#.###.#####.#.###.#########.###.###.#.###.###.###.###########.#####.#####.#.###.###.###.###.#.###.#.#.#.#
|
||||||
|
#.....#.#.#.....#...#...#.#.#.#.....#...#...#.........#.....#.#.........#...#.......#...#...#.........#.......#.....#...#.........#...#.....#
|
||||||
|
#.#.#.#.#.#############.#.#.#########.#.#####.###.###.#.###.#.#######.#.###.###.###.###.#.#.#.#######.#.###.#########.###.#####.###.###.#.###
|
||||||
|
#...#.#...#...#.........#.#.........#.#.#.....#.#...#.#.#.#.#...........#...#.#.........#.#.#...#...#.#.........#...#.............#...#.....#
|
||||||
|
###.###.#.###.#.#######.#.#####.###.#.#.#.#####.###.###.#.#.###########.#.###.#######.#####.###.#.#.#.#########.###.#######.#####.###.#.#.###
|
||||||
|
#...#.........#.#.#.....#.......#...#.#...........#.....#.#...#.....#...#.........#...#...#.....#.#.#...#.....#...........#.#.....#...#.#...#
|
||||||
|
#.###.#.#######.#.#.#####.#.#.###.###.#####.#.#########.#.###.#.###.#############.#.#.#.#.#.#####.#.###.###.#########.#####.#.#####.###.#.#.#
|
||||||
|
#.....#.........#.......#.#.#...#...#...#...#.....#...........#...#.........#.....#.#...#.#.......#...#...#.....#.....#.....#.....#.........#
|
||||||
|
#.#####.#########.###.###.#.###.###.###.#.#######.#.#.#.###.#.###.#.#####.###.#.#########.#####.#########.#.###.#.#####.#########.#.###.###.#
|
||||||
|
#.....#...#.........#...#.#.#.#...#...#.#.......#.....#.#...#...#.....#...#...#...........#.#...#.............#.........#.......#.#...#...#.#
|
||||||
|
#####.###.#.#######.#.#.#.#.#.#.#.#.#.#.#####.#########.#.###########.#.###.#####.#########.#.###.###########.#########.#.#.###.#.###.#.#.#.#
|
||||||
|
#...#...#.#.#.....#.#.#...#...#.#.#.#.#...#...#.....#...#.......#.....#.....#.....#.......#.#...#.#.......#...#.#.......#.#.................#
|
||||||
|
#.###.#.#.#.#.###.#.#.#########.###.#####.###.#.###.#.#########.#.###########.#.###.#####.#.###.#.#####.#.#.###.#.###########.###.###.#.###.#
|
||||||
|
#.......#.#.#...........#.....#...#.....#...#.#.#...#.........#.#.#...#.....#.#...#.#...#.#.#...#.....#.#.#.....#.#.........#.#...#...#.....#
|
||||||
|
#.#.#####.#.###.#.#####.#.###.#.#.#####.###.###.#.#######.#####.#.#.###.###.#.###.#.#.#.#.#.#.#####.#.#.#.#####.#.#####.###.#.#.#.#.###.#.###
|
||||||
|
#...#.#.......#.#...#...#.#...#.#.....#...#.....#.....#...#...#...#.....#.#...#.#.#...#.#...#...#...#.#.......#.#.......#...#.#.#.#.....#.#.#
|
||||||
|
#.#.#.#.#.#####.###.#.###.#.###.###.#.###.###########.#.###.#.#.#.#.#####.###.#.#.#####.#######.#.#.#.#.###.###.#########.###.#.#######.#.#.#
|
||||||
|
#.......#.#.....#.#...#...#.#.#.#.#.#.#.#...#.....#.............................#.#...#.......#.#.#.#.#.#.#.#.....#.......#...#.........#...#
|
||||||
|
#####.#.#.#.#####.#######.#.#.#.#.#.#.#.###.#.###.#.#########.#####.#.#########.#.#.#.#.###.###.###.#.#.#.#.#.#####.#######.#.#######.#.###.#
|
||||||
|
#.....#...........................#.#.#...#.#.#.#.#.........#...#...#...#.....#.#...#.#.#...#...#...#.#...#...#.#...#.......#.....#...#...#.#
|
||||||
|
#.#####.#.#.#####.#.#.###.#.#.###.#.#.#.###.#.#.#.#########.#.###.#.#.#.#####.#.#####.#.#.#.#.###.#.#.###.#####.#.#####.#.#######.#.###.#.#.#
|
||||||
|
#.#.....#.#.#...#.#...#.....#.....#.#.#.#...#.#.#...................#.......#.#.#.....#.#.#.#...#.#...#.....#...#.....#.#.....#.#.#...#...#.#
|
||||||
|
###.#####.#.#.#.#.#####.#.#######.#.#.#.#.###.#.###.###.###########.###.###.#.#.#.#.###.#.#####.#.#.#######.#.#######.#######.#.#.###.#.###.#
|
||||||
|
#...#.....#...#.#...#...#.......#.#.#.#...........................#.........#...#.#.#...#.....#.#.#...#...#...#.....#...#.....#...#.#.#...#.#
|
||||||
|
#.#############.###.#.###.###.#.###.#.#.#########.#.#.#####.#####.#.###.#########.#.#.#####.###.#.###.#.#.#####.#.#####.#.#####.###.#.#####.#
|
||||||
|
#S..................#.........#.....#.............#.........#.....................#.......#.........#...#.......#.........#.........#.......#
|
||||||
|
#############################################################################################################################################
|
||||||
|
|||||||
@@ -0,0 +1,5 @@
|
|||||||
|
Register A: 53437164
|
||||||
|
Register B: 0
|
||||||
|
Register C: 0
|
||||||
|
|
||||||
|
Program: 2,4,1,7,7,5,4,1,1,4,5,5,0,3,3,0
|
||||||
|
|||||||
File diff suppressed because one or more lines are too long
4
src/holt59/aoc/inputs/tests/2015/day23.txt
Normal file
4
src/holt59/aoc/inputs/tests/2015/day23.txt
Normal file
@@ -0,0 +1,4 @@
|
|||||||
|
inc a
|
||||||
|
jio a, +2
|
||||||
|
tpl a
|
||||||
|
inc a
|
||||||
10
src/holt59/aoc/inputs/tests/2015/day24.txt
Normal file
10
src/holt59/aoc/inputs/tests/2015/day24.txt
Normal file
@@ -0,0 +1,10 @@
|
|||||||
|
1
|
||||||
|
2
|
||||||
|
3
|
||||||
|
4
|
||||||
|
5
|
||||||
|
7
|
||||||
|
8
|
||||||
|
9
|
||||||
|
10
|
||||||
|
11
|
||||||
1
src/holt59/aoc/inputs/tests/2015/day25.txt
Normal file
1
src/holt59/aoc/inputs/tests/2015/day25.txt
Normal file
@@ -0,0 +1 @@
|
|||||||
|
To continue, please consult the code grid in the manual. Enter the code at row 6, column 5.
|
||||||
@@ -0,0 +1,10 @@
|
|||||||
|
[({(<(())[]>[[{[]{<()<>>
|
||||||
|
[(()[<>])]({[<{<<[]>>(
|
||||||
|
{([(<{}[<>[]}>{[]{[(<()>
|
||||||
|
(((({<>}<{<{<>}{[]{[]{}
|
||||||
|
[[<[([]))<([[{}[[()]]]
|
||||||
|
[{[{({}]{}}([{[{{{}}([]
|
||||||
|
{<[[]]>}<{[{[{[]{()[[[]
|
||||||
|
[<(<(<(<{}))><([]([]()
|
||||||
|
<{([([[(<>()){}]>(<<{{
|
||||||
|
<{([{{}}[<[[[<>{}]]]>[]]
|
||||||
|
|||||||
@@ -0,0 +1,10 @@
|
|||||||
|
5483143223
|
||||||
|
2745854711
|
||||||
|
5264556173
|
||||||
|
6141336146
|
||||||
|
6357385478
|
||||||
|
4167524645
|
||||||
|
2176841721
|
||||||
|
6882881134
|
||||||
|
4846848554
|
||||||
|
5283751526
|
||||||
|
|||||||
@@ -0,0 +1,18 @@
|
|||||||
|
fs-end
|
||||||
|
he-DX
|
||||||
|
fs-he
|
||||||
|
start-DX
|
||||||
|
pj-DX
|
||||||
|
end-zg
|
||||||
|
zg-sl
|
||||||
|
zg-pj
|
||||||
|
pj-he
|
||||||
|
RW-he
|
||||||
|
fs-DX
|
||||||
|
pj-RW
|
||||||
|
zg-RW
|
||||||
|
start-pj
|
||||||
|
he-WI
|
||||||
|
zg-he
|
||||||
|
pj-fs
|
||||||
|
start-RW
|
||||||
|
|||||||
@@ -0,0 +1,8 @@
|
|||||||
|
89010123
|
||||||
|
78121874
|
||||||
|
87430965
|
||||||
|
96549874
|
||||||
|
45678903
|
||||||
|
32019012
|
||||||
|
01329801
|
||||||
|
10456732
|
||||||
|
|||||||
@@ -0,0 +1 @@
|
|||||||
|
125 17
|
||||||
|
|||||||
@@ -0,0 +1,10 @@
|
|||||||
|
RRRRIICCFF
|
||||||
|
RRRRIICCCF
|
||||||
|
VVRRRCCFFF
|
||||||
|
VVRCCCJFFF
|
||||||
|
VVVVCJJCFE
|
||||||
|
VVIVCCJJEE
|
||||||
|
VVIIICJJEE
|
||||||
|
MIIIIIJJEE
|
||||||
|
MIIISIJEEE
|
||||||
|
MMMISSJEEE
|
||||||
|
|||||||
@@ -0,0 +1,15 @@
|
|||||||
|
Button A: X+94, Y+34
|
||||||
|
Button B: X+22, Y+67
|
||||||
|
Prize: X=8400, Y=5400
|
||||||
|
|
||||||
|
Button A: X+26, Y+66
|
||||||
|
Button B: X+67, Y+21
|
||||||
|
Prize: X=12748, Y=12176
|
||||||
|
|
||||||
|
Button A: X+17, Y+86
|
||||||
|
Button B: X+84, Y+37
|
||||||
|
Prize: X=7870, Y=6450
|
||||||
|
|
||||||
|
Button A: X+69, Y+23
|
||||||
|
Button B: X+27, Y+71
|
||||||
|
Prize: X=18641, Y=10279
|
||||||
|
|||||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user